diff --git a/go.mod b/go.mod index 78090bff..df01cac9 100644 --- a/go.mod +++ b/go.mod @@ -3,7 +3,7 @@ module github.com/spotinst/spotctl go 1.16 require ( - github.com/AlecAivazis/survey/v2 v2.3.4 + github.com/AlecAivazis/survey/v2 v2.3.7 github.com/aws/aws-sdk-go v1.44.114 github.com/dustin/go-humanize v1.0.0 github.com/fsnotify/fsnotify v1.5.1 // indirect diff --git a/go.sum b/go.sum index 01b43516..fbf85464 100644 --- a/go.sum +++ b/go.sum @@ -36,8 +36,8 @@ cloud.google.com/go/storage v1.6.0/go.mod h1:N7U0C8pVQ/+NIKOBQyamJIeKQKkZ+mxpohl cloud.google.com/go/storage v1.8.0/go.mod h1:Wv1Oy7z6Yz3DshWRJFhqM/UCfaWIRTdp0RXyy7KQOVs= cloud.google.com/go/storage v1.10.0/go.mod h1:FLPqc6j+Ki4BU591ie1oL6qBQGu2Bl/tZ9ullr3+Kg0= dmitri.shuralyov.com/gpu/mtl v0.0.0-20190408044501-666a987793e9/go.mod h1:H6x//7gZCb22OMCxBHrMx7a5I7Hp++hsVxbQ4BYO7hU= -github.com/AlecAivazis/survey/v2 v2.3.4 h1:pchTU9rsLUSvWEl2Aq9Pv3k0IE2fkqtGxazskAMd9Ng= -github.com/AlecAivazis/survey/v2 v2.3.4/go.mod h1:hrV6Y/kQCLhIZXGcriDCUBtB3wnN7156gMXJ3+b23xM= +github.com/AlecAivazis/survey/v2 v2.3.7 h1:6I/u8FvytdGsgonrYsVn2t8t4QiRnh6QSTqkkhIiSjQ= +github.com/AlecAivazis/survey/v2 v2.3.7/go.mod h1:xUTIdE4KCOIjsBAE1JYsUPoCqYdZ1reCfTwbto0Fduo= github.com/Azure/go-autorest v14.2.0+incompatible/go.mod h1:r+4oMnoxhatjLLJ6zxSWATqVooLgysK6ZNox3g/xq24= github.com/Azure/go-autorest/autorest v0.11.18/go.mod h1:dSiJPy22c3u0OtOKDNttNgqpNFY/GeWa7GH/Pz56QRA= github.com/Azure/go-autorest/autorest/adal v0.9.13/go.mod h1:W/MM4U6nLxnIskrw4UwWzlHfGjwUS50aOsc/I3yuU8M= @@ -321,6 +321,7 @@ github.com/yuin/goldmark v1.1.27/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9de github.com/yuin/goldmark v1.1.32/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= github.com/yuin/goldmark v1.2.1/go.mod h1:3hX8gzYuyVAZsxl0MRgGTJEmQBFcNTphYh9decYSb74= github.com/yuin/goldmark v1.3.5/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k= +github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY= go.opencensus.io v0.21.0/go.mod h1:mSImk1erAIZhrmZN+AvHh14ztQfjbGwt4TtuofqLduU= go.opencensus.io v0.22.0/go.mod h1:+kGneAE2xo2IficOXnaByMWTGM9T73dGwxeWcUqIpI8= go.opencensus.io v0.22.2/go.mod h1:yxeiOL68Rb0Xd1ddK5vPZ/oVn4vY4Ynel7k9FzqtOIw= @@ -335,6 +336,7 @@ golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8U golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20201002170205-7f63de1d35b0/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20210817164053-32db794688a5/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= +golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -369,6 +371,7 @@ golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.1/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= +golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180906233101-161cd47e91fd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -407,8 +410,9 @@ golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v golang.org/x/net v0.0.0-20210316092652-d523dce5a7f4/go.mod h1:RBQZq4jEuRlivfhVLdyRGr576XBO4/greRjx4P4O3yc= golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96bSt6lcn1PtDYWL6XObtHCRCNQM= golang.org/x/net v0.0.0-20211209124913-491a49abca63/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= -golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd h1:O7DYs+zxREGLKzKoMQrtrEacpb0ZVXA5rIwylE2Xchk= golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= +golang.org/x/net v0.0.0-20220722155237-a158d28d115b h1:PxfKdU9lEEDYjdIzOtC4qFWgkU2rGHdKlKowJSMN9h0= +golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -434,6 +438,7 @@ golang.org/x/sync v0.0.0-20200625203802-6e8e738ad208/go.mod h1:RxMgew5VJxzue5/jJ golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20201207232520-09787c993a3a/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180909124046-d0be0721c37e/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -483,10 +488,11 @@ golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210831042530-f4d43177bf5e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e h1:fLOSk5Q00efkSvAm+4xcoXD+RRmLmmulPn5I3Y9F2EM= golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f h1:v4INt8xihDGvnrfjMDVXGxw9wrfxYyCjk0KbXjhR55s= +golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= -golang.org/x/term v0.0.0-20210503060354-a79de5458b56/go.mod h1:tfny5GFUkzUvx4ps4ajbZsCe5lw1metzhBm9T3x7oIY= golang.org/x/term v0.0.0-20210615171337-6886f2dfbf5b/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211 h1:JGgROgKl9N8DuW20oFS5gxc+lE67/N3FcwmBPMe7ArY= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= @@ -498,8 +504,9 @@ golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.4/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.5/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.3.7 h1:olpwvP2KacW1ZWvsR7uQhoyTYvKAupfQrRGBFM352Gk= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= +golang.org/x/text v0.4.0 h1:BrVqGRd7+k1DiOgtnFvAkoQEWQvBc25ouMJM6429SFg= +golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -555,6 +562,7 @@ golang.org/x/tools v0.0.0-20210105154028-b0ab187a4818/go.mod h1:emZCQorbCU4vsT4f golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= golang.org/x/tools v0.1.0/go.mod h1:xkSsbof2nBLbhDlRMhhhyNLN/zl3eTqcnHD5viDpcZ0= golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= +golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= diff --git a/vendor/github.com/AlecAivazis/survey/v2/README.md b/vendor/github.com/AlecAivazis/survey/v2/README.md index 92997f62..ba75b329 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/README.md +++ b/vendor/github.com/AlecAivazis/survey/v2/README.md @@ -193,6 +193,28 @@ prompt := &survey.MultiSelect{..., PageSize: 10} survey.AskOne(prompt, &days, survey.WithPageSize(10)) ``` +#### Select options description + +The optional description text can be used to add extra information to each option listed in the select prompt: + +```golang +color := "" +prompt := &survey.Select{ + Message: "Choose a color:", + Options: []string{"red", "blue", "green"}, + Description: func(value string, index int) string { + if value == "red" { + return "My favorite color" + } + return "" + }, +} +survey.AskOne(prompt, &color) + +// Assuming that the user chose "red - My favorite color": +fmt.Println(color) //=> "red" +``` + ### MultiSelect ![Example](img/multi-select-all-none.gif) @@ -335,6 +357,39 @@ All of the prompts have a `Help` field which can be defined to provide more info } ``` +## Removing the "Select All" and "Select None" options + +By default, users can select all of the multi-select options using the right arrow key. To prevent users from being able to do this (and remove the ` to all` message from the prompt), use the option `WithRemoveSelectAll`: + +```golang +import ( + "github.com/AlecAivazis/survey/v2" +) + +number := "" +prompt := &survey.Input{ + Message: "This question has the select all option removed", +} + +survey.AskOne(prompt, &number, survey.WithRemoveSelectAll()) +``` + +Also by default, users can use the left arrow key to unselect all of the options. To prevent users from being able to do this (and remove the ` to none` message from the prompt), use the option `WithRemoveSelectNone`: + +```golang +import ( + "github.com/AlecAivazis/survey/v2" +) + +number := "" +prompt := &survey.Input{ + Message: "This question has the select all option removed", +} + +survey.AskOne(prompt, &number, survey.WithRemoveSelectNone()) +``` + + ### Changing the input rune In some situations, `?` is a perfectly valid response. To handle this, you can change the rune that survey diff --git a/vendor/github.com/AlecAivazis/survey/v2/confirm.go b/vendor/github.com/AlecAivazis/survey/v2/confirm.go index 9662e6cd..1c23fb4d 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/confirm.go +++ b/vendor/github.com/AlecAivazis/survey/v2/confirm.go @@ -90,6 +90,7 @@ func (c *Confirm) getBool(showHelp bool, config *PromptConfig) (bool, error) { continue default: // we didnt get a valid answer, so print error and prompt again + //lint:ignore ST1005 it should be fine for this error message to have punctuation if err := c.Error(config, fmt.Errorf("%q is not a valid answer, please try again.", val)); err != nil { return c.Default, err } diff --git a/vendor/github.com/AlecAivazis/survey/v2/core/template.go b/vendor/github.com/AlecAivazis/survey/v2/core/template.go index 6b3d20cd..02da879d 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/core/template.go +++ b/vendor/github.com/AlecAivazis/survey/v2/core/template.go @@ -2,6 +2,7 @@ package core import ( "bytes" + "os" "sync" "text/template" @@ -23,11 +24,22 @@ var TemplateFuncsNoColor = map[string]interface{}{ }, } -//RunTemplate returns two formatted strings given a template and -//the data it requires. The first string returned is generated for -//user-facing output and may or may not contain ANSI escape codes -//for colored output. The second string does not contain escape codes -//and can be used by the renderer for layout purposes. +// envColorDisabled returns if output colors are forbid by environment variables +func envColorDisabled() bool { + return os.Getenv("NO_COLOR") != "" || os.Getenv("CLICOLOR") == "0" +} + +// envColorForced returns if output colors are forced from environment variables +func envColorForced() bool { + val, ok := os.LookupEnv("CLICOLOR_FORCE") + return ok && val != "0" +} + +// RunTemplate returns two formatted strings given a template and +// the data it requires. The first string returned is generated for +// user-facing output and may or may not contain ANSI escape codes +// for colored output. The second string does not contain escape codes +// and can be used by the renderer for layout purposes. func RunTemplate(tmpl string, data interface{}) (string, string, error) { tPair, err := GetTemplatePair(tmpl) if err != nil { @@ -52,11 +64,11 @@ var ( memoMutex = &sync.RWMutex{} ) -//GetTemplatePair returns a pair of compiled templates where the -//first template is generated for user-facing output and the -//second is generated for use by the renderer. The second -//template does not contain any color escape codes, whereas -//the first template may or may not depending on DisableColor. +// GetTemplatePair returns a pair of compiled templates where the +// first template is generated for user-facing output and the +// second is generated for use by the renderer. The second +// template does not contain any color escape codes, whereas +// the first template may or may not depending on DisableColor. func GetTemplatePair(tmpl string) ([2]*template.Template, error) { memoMutex.RLock() if t, ok := memoizedGetTemplate[tmpl]; ok { @@ -74,7 +86,8 @@ func GetTemplatePair(tmpl string) ([2]*template.Template, error) { templatePair[1] = templateNoColor - if DisableColor { + envColorHide := envColorDisabled() && !envColorForced() + if DisableColor || envColorHide { templatePair[0] = templatePair[1] } else { templateWithColor, err := template.New("prompt").Funcs(TemplateFuncsWithColor).Parse(tmpl) diff --git a/vendor/github.com/AlecAivazis/survey/v2/core/write.go b/vendor/github.com/AlecAivazis/survey/v2/core/write.go index 94a886c3..2225e3b2 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/core/write.go +++ b/vendor/github.com/AlecAivazis/survey/v2/core/write.go @@ -142,12 +142,12 @@ func (err errFieldNotMatch) Is(target error) bool { // implements the dynamic er // It returns the Question.Name that couldn't be matched with a destination field. // // Usage: -// err := survey.Ask(qs, &v); -// if err != nil { -// if name, ok := core.IsFieldNotMatch(err); ok { -// [...name is the not matched question name] -// } -// } +// +// if err := survey.Ask(qs, &v); err != nil { +// if name, ok := core.IsFieldNotMatch(err); ok { +// // name is the question name that did not match a field +// } +// } func IsFieldNotMatch(err error) (string, bool) { if err != nil { if v, ok := err.(errFieldNotMatch); ok { @@ -301,6 +301,7 @@ func copy(t reflect.Value, v reflect.Value) (err error) { case reflect.Float64: castVal, casterr = strconv.ParseFloat(vString, 64) default: + //lint:ignore ST1005 allow this error message to be capitalized return fmt.Errorf("Unable to convert from string to type %s", t.Kind()) } @@ -335,6 +336,7 @@ func copy(t reflect.Value, v reflect.Value) (err error) { } // we're copying an option answer to an incorrect type + //lint:ignore ST1005 allow this error message to be capitalized return fmt.Errorf("Unable to convert from OptionAnswer to type %s", t.Kind()) } diff --git a/vendor/github.com/AlecAivazis/survey/v2/go.mod b/vendor/github.com/AlecAivazis/survey/v2/go.mod index 56687708..4837ce75 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/go.mod +++ b/vendor/github.com/AlecAivazis/survey/v2/go.mod @@ -10,8 +10,8 @@ require ( github.com/mattn/go-isatty v0.0.8 github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b github.com/stretchr/testify v1.6.1 - golang.org/x/term v0.0.0-20210503060354-a79de5458b56 - golang.org/x/text v0.3.3 + golang.org/x/term v0.0.0-20210927222741-03fcf44c2211 + golang.org/x/text v0.4.0 ) go 1.13 diff --git a/vendor/github.com/AlecAivazis/survey/v2/go.sum b/vendor/github.com/AlecAivazis/survey/v2/go.sum index 04c33143..a19168d0 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/go.sum +++ b/vendor/github.com/AlecAivazis/survey/v2/go.sum @@ -20,14 +20,34 @@ github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZN github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.6.1 h1:hDPOHmpOpP40lSULcqw7IrRb/u7w6RpDC9399XyoNd0= github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY= +golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= +golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= +golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= +golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= +golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg= +golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= +golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190222072716-a9d3bda3a223/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= -golang.org/x/sys v0.0.0-20201119102817-f84b799fce68 h1:nxC68pudNYkKU6jWhgrqdreuFiOQWj1Fs7T3VrH4Pjw= golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/term v0.0.0-20210503060354-a79de5458b56 h1:b8jxX3zqjpqb2LklXPzKSGJhzyxCOZSz8ncv8Nv+y7w= -golang.org/x/term v0.0.0-20210503060354-a79de5458b56/go.mod h1:tfny5GFUkzUvx4ps4ajbZsCe5lw1metzhBm9T3x7oIY= -golang.org/x/text v0.3.3 h1:cokOdA+Jmi5PJGXLlLllQSgYigAEfHXJAERHVMaCc2k= +golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f h1:v4INt8xihDGvnrfjMDVXGxw9wrfxYyCjk0KbXjhR55s= +golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= +golang.org/x/term v0.0.0-20210927222741-03fcf44c2211 h1:JGgROgKl9N8DuW20oFS5gxc+lE67/N3FcwmBPMe7ArY= +golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= +golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= +golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= +golang.org/x/text v0.4.0 h1:BrVqGRd7+k1DiOgtnFvAkoQEWQvBc25ouMJM6429SFg= +golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= +golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= +golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= +golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c h1:dUUwHk2QECo/6vqA44rthZ8ie2QXMNeKRTHCNY2nXvo= diff --git a/vendor/github.com/AlecAivazis/survey/v2/input.go b/vendor/github.com/AlecAivazis/survey/v2/input.go index dbc7c08c..04747638 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/input.go +++ b/vendor/github.com/AlecAivazis/survey/v2/input.go @@ -127,14 +127,14 @@ func (i *Input) onRune(config *PromptConfig) terminal.OnRuneFn { ) if err == nil { - err = readLineAgain + err = errReadLineAgain } return []rune(i.typedAnswer), true, err }) } -var readLineAgain = errors.New("read line again") +var errReadLineAgain = errors.New("read line again") func (i *Input) Prompt(config *PromptConfig) (interface{}, error) { // render the template @@ -170,7 +170,7 @@ func (i *Input) Prompt(config *PromptConfig) (interface{}, error) { } line, err = rr.ReadLineWithDefault(0, line, i.onRune(config)) - if err == readLineAgain { + if err == errReadLineAgain { continue } @@ -207,20 +207,13 @@ func (i *Input) Prompt(config *PromptConfig) (interface{}, error) { } func (i *Input) Cleanup(config *PromptConfig, val interface{}) error { - // use the default answer when cleaning up the prompt if necessary - ans := i.answer - if ans == "" && i.Default != "" { - ans = i.Default - } - - // render the cleanup return i.Render( InputQuestionTemplate, InputTemplateData{ Input: *i, ShowAnswer: true, Config: config, - Answer: ans, + Answer: val.(string), }, ) } diff --git a/vendor/github.com/AlecAivazis/survey/v2/multiselect.go b/vendor/github.com/AlecAivazis/survey/v2/multiselect.go index 3251ea1c..396169f3 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/multiselect.go +++ b/vendor/github.com/AlecAivazis/survey/v2/multiselect.go @@ -29,6 +29,7 @@ type MultiSelect struct { VimMode bool FilterMessage string Filter func(filter string, value string, index int) bool + Description func(value string, index int) string filter string selectedIndex int checked map[int]bool @@ -43,6 +44,7 @@ type MultiSelectTemplateData struct { Checked map[int]bool SelectedIndex int ShowHelp bool + Description func(value string, index int) string PageEntries []core.OptionAnswer Config *PromptConfig @@ -59,19 +61,26 @@ func (m MultiSelectTemplateData) IterateOption(ix int, opt core.OptionAnswer) in return copy } +func (m MultiSelectTemplateData) GetDescription(opt core.OptionAnswer) string { + if m.Description == nil { + return "" + } + return m.Description(opt.Value, opt.Index) +} + var MultiSelectQuestionTemplate = ` {{- define "option"}} {{- if eq .SelectedIndex .CurrentIndex }}{{color .Config.Icons.SelectFocus.Format }}{{ .Config.Icons.SelectFocus.Text }}{{color "reset"}}{{else}} {{end}} {{- if index .Checked .CurrentOpt.Index }}{{color .Config.Icons.MarkedOption.Format }} {{ .Config.Icons.MarkedOption.Text }} {{else}}{{color .Config.Icons.UnmarkedOption.Format }} {{ .Config.Icons.UnmarkedOption.Text }} {{end}} {{- color "reset"}} - {{- " "}}{{- .CurrentOpt.Value}} + {{- " "}}{{- .CurrentOpt.Value}}{{ if ne ($.GetDescription .CurrentOpt) "" }} - {{color "cyan"}}{{ $.GetDescription .CurrentOpt }}{{color "reset"}}{{end}} {{end}} {{- if .ShowHelp }}{{- color .Config.Icons.Help.Format }}{{ .Config.Icons.Help.Text }} {{ .Help }}{{color "reset"}}{{"\n"}}{{end}} {{- color .Config.Icons.Question.Format }}{{ .Config.Icons.Question.Text }} {{color "reset"}} {{- color "default+hb"}}{{ .Message }}{{ .FilterMessage }}{{color "reset"}} {{- if .ShowAnswer}}{{color "cyan"}} {{.Answer}}{{color "reset"}}{{"\n"}} {{- else }} - {{- " "}}{{- color "cyan"}}[Use arrows to move, space to select, to all, to none, type to filter{{- if and .Help (not .ShowHelp)}}, {{ .Config.HelpInput }} for more help{{end}}]{{color "reset"}} + {{- " "}}{{- color "cyan"}}[Use arrows to move, space to select,{{- if not .Config.RemoveSelectAll }} to all,{{end}}{{- if not .Config.RemoveSelectNone }} to none,{{end}} type to filter{{- if and .Help (not .ShowHelp)}}, {{ .Config.HelpInput }} for more help{{end}}]{{color "reset"}} {{- "\n"}} {{- range $ix, $option := .PageEntries}} {{- template "option" $.IterateOption $ix $option}} @@ -134,14 +143,14 @@ func (m *MultiSelect) OnChange(key rune, config *PromptConfig) { } else if key >= terminal.KeySpace { m.filter += string(key) m.VimMode = false - } else if key == terminal.KeyArrowRight { + } else if !config.RemoveSelectAll && key == terminal.KeyArrowRight { for _, v := range options { m.checked[v.Index] = true } if !config.KeepFilter { m.filter = "" } - } else if key == terminal.KeyArrowLeft { + } else if !config.RemoveSelectNone && key == terminal.KeyArrowLeft { for _, v := range options { m.checked[v.Index] = false } @@ -179,6 +188,7 @@ func (m *MultiSelect) OnChange(key rune, config *PromptConfig) { SelectedIndex: idx, Checked: m.checked, ShowHelp: m.showingHelp, + Description: m.Description, PageEntries: opts, Config: config, } @@ -272,6 +282,7 @@ func (m *MultiSelect) Prompt(config *PromptConfig) (interface{}, error) { tmplData := MultiSelectTemplateData{ MultiSelect: *m, SelectedIndex: idx, + Description: m.Description, Checked: m.checked, PageEntries: opts, Config: config, @@ -342,6 +353,7 @@ func (m *MultiSelect) Cleanup(config *PromptConfig, val interface{}) error { Checked: m.checked, Answer: answer, ShowAnswer: true, + Description: m.Description, Config: config, }, ) diff --git a/vendor/github.com/AlecAivazis/survey/v2/password.go b/vendor/github.com/AlecAivazis/survey/v2/password.go index 877102c6..96a2ae89 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/password.go +++ b/vendor/github.com/AlecAivazis/survey/v2/password.go @@ -60,7 +60,7 @@ func (p *Password) Prompt(config *PromptConfig) (interface{}, error) { // no help msg? Just return any response if p.Help == "" { - line, err := rr.ReadLine('*') + line, err := rr.ReadLine(config.HideCharacter) return string(line), err } @@ -69,7 +69,7 @@ func (p *Password) Prompt(config *PromptConfig) (interface{}, error) { var line []rune // process answers looking for help prompt answer for { - line, err = rr.ReadLine('*') + line, err = rr.ReadLine(config.HideCharacter) if err != nil { return string(line), err } @@ -96,7 +96,7 @@ func (p *Password) Prompt(config *PromptConfig) (interface{}, error) { } lineStr := string(line) - p.AppendRenderedText(strings.Repeat("*", len(lineStr))) + p.AppendRenderedText(strings.Repeat(string(config.HideCharacter), len(lineStr))) return lineStr, err } diff --git a/vendor/github.com/AlecAivazis/survey/v2/renderer.go b/vendor/github.com/AlecAivazis/survey/v2/renderer.go index a89b061e..a16207de 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/renderer.go +++ b/vendor/github.com/AlecAivazis/survey/v2/renderer.go @@ -3,8 +3,6 @@ package survey import ( "bytes" "fmt" - "unicode/utf8" - "github.com/AlecAivazis/survey/v2/core" "github.com/AlecAivazis/survey/v2/terminal" "golang.org/x/term" @@ -180,7 +178,8 @@ func (r *Renderer) countLines(buf bytes.Buffer) int { delim = len(bufBytes) // no new line found, read rest of text } - if lineWidth := utf8.RuneCount(bufBytes[curr:delim]); lineWidth > w { + str := string(bufBytes[curr:delim]) + if lineWidth := terminal.StringWidth(str); lineWidth > w { // account for word wrapping count += lineWidth / w if (lineWidth % w) == 0 { diff --git a/vendor/github.com/AlecAivazis/survey/v2/select.go b/vendor/github.com/AlecAivazis/survey/v2/select.go index 5c4996f9..1210122f 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/select.go +++ b/vendor/github.com/AlecAivazis/survey/v2/select.go @@ -2,6 +2,7 @@ package survey import ( "errors" + "fmt" "github.com/AlecAivazis/survey/v2/core" "github.com/AlecAivazis/survey/v2/terminal" @@ -28,9 +29,9 @@ type Select struct { VimMode bool FilterMessage string Filter func(filter string, value string, index int) bool + Description func(value string, index int) string filter string selectedIndex int - useDefault bool showingHelp bool } @@ -42,6 +43,7 @@ type SelectTemplateData struct { Answer string ShowAnswer bool ShowHelp bool + Description func(value string, index int) string Config *PromptConfig // These fields are used when rendering an individual option @@ -57,10 +59,17 @@ func (s SelectTemplateData) IterateOption(ix int, opt core.OptionAnswer) interfa return copy } +func (s SelectTemplateData) GetDescription(opt core.OptionAnswer) string { + if s.Description == nil { + return "" + } + return s.Description(opt.Value, opt.Index) +} + var SelectQuestionTemplate = ` {{- define "option"}} {{- if eq .SelectedIndex .CurrentIndex }}{{color .Config.Icons.SelectFocus.Format }}{{ .Config.Icons.SelectFocus.Text }} {{else}}{{color "default"}} {{end}} - {{- .CurrentOpt.Value}} + {{- .CurrentOpt.Value}}{{ if ne ($.GetDescription .CurrentOpt) "" }} - {{color "cyan"}}{{ $.GetDescription .CurrentOpt }}{{end}} {{- color "reset"}} {{end}} {{- if .ShowHelp }}{{- color .Config.Icons.Help.Format }}{{ .Config.Icons.Help.Text }} {{ .Help }}{{color "reset"}}{{"\n"}}{{end}} @@ -94,8 +103,6 @@ func (s *Select) OnChange(key rune, config *PromptConfig) bool { // if the user pressed the up arrow or 'k' to emulate vim } else if (key == terminal.KeyArrowUp || (s.VimMode && key == 'k')) && len(options) > 0 { - s.useDefault = false - // if we are at the top of the list if s.selectedIndex == 0 { // start from the button @@ -107,7 +114,6 @@ func (s *Select) OnChange(key rune, config *PromptConfig) bool { // if the user pressed down or 'j' to emulate vim } else if (key == terminal.KeyTab || key == terminal.KeyArrowDown || (s.VimMode && key == 'j')) && len(options) > 0 { - s.useDefault = false // if we are at the bottom of the list if s.selectedIndex == len(options)-1 { // start from the top @@ -138,8 +144,6 @@ func (s *Select) OnChange(key rune, config *PromptConfig) bool { s.filter += string(key) // make sure vim mode is disabled s.VimMode = false - // make sure that we use the current value in the filtered list - s.useDefault = false } s.FilterMessage = "" @@ -171,6 +175,7 @@ func (s *Select) OnChange(key rune, config *PromptConfig) bool { Select: *s, SelectedIndex: idx, ShowHelp: s.showingHelp, + Description: s.Description, PageEntries: opts, Config: config, } @@ -197,7 +202,6 @@ func (s *Select) filterOptions(config *PromptConfig) []core.OptionAnswer { filter = config.Filter } - // for i, opt := range s.Options { // i the filter says to include the option if filter(s.filter, opt, i) { @@ -219,23 +223,29 @@ func (s *Select) Prompt(config *PromptConfig) (interface{}, error) { return "", errors.New("please provide options to select from") } - // start off with the first option selected - sel := 0 - // if there is a default - if s.Default != "" { - // find the choice - for i, opt := range s.Options { - // if the option corresponds to the default - if opt == s.Default { - // we found our initial value - sel = i - // stop looking - break + s.selectedIndex = 0 + if s.Default != nil { + switch defaultValue := s.Default.(type) { + case string: + var found bool + for i, opt := range s.Options { + if opt == defaultValue { + s.selectedIndex = i + found = true + } } + if !found { + return "", fmt.Errorf("default value %q not found in options", defaultValue) + } + case int: + if defaultValue >= len(s.Options) { + return "", fmt.Errorf("default index %d exceeds the number of options", defaultValue) + } + s.selectedIndex = defaultValue + default: + return "", errors.New("default value of select must be an int or string") } } - // save the selected index - s.selectedIndex = sel // figure out the page size pageSize := s.PageSize @@ -246,7 +256,7 @@ func (s *Select) Prompt(config *PromptConfig) (interface{}, error) { } // figure out the options and index to render - opts, idx := paginate(pageSize, core.OptionAnswerList(s.Options), sel) + opts, idx := paginate(pageSize, core.OptionAnswerList(s.Options), s.selectedIndex) cursor := s.NewCursor() cursor.Save() // for proper cursor placement during selection @@ -257,6 +267,7 @@ func (s *Select) Prompt(config *PromptConfig) (interface{}, error) { tmplData := SelectTemplateData{ Select: *s, SelectedIndex: idx, + Description: s.Description, ShowHelp: s.showingHelp, PageEntries: opts, Config: config, @@ -268,9 +279,6 @@ func (s *Select) Prompt(config *PromptConfig) (interface{}, error) { return "", err } - // by default, use the default value - s.useDefault = true - rr := s.NewRuneReader() _ = rr.SetTermMode() defer func() { @@ -293,45 +301,16 @@ func (s *Select) Prompt(config *PromptConfig) (interface{}, error) { break } } + options := s.filterOptions(config) s.filter = "" s.FilterMessage = "" - // the index to report - var val string - // if we are supposed to use the default value - if s.useDefault || s.selectedIndex >= len(options) { - // if there is a default value - if s.Default != nil { - // if the default is a string - if defaultString, ok := s.Default.(string); ok { - // use the default value - val = defaultString - // the default value could also be an interpret which is interpretted as the index - } else if defaultIndex, ok := s.Default.(int); ok { - val = s.Options[defaultIndex] - } else { - return val, errors.New("default value of select must be an int or string") - } - } else if len(options) > 0 { - // there is no default value so use the first - val = options[0].Value - } - // otherwise the selected index points to the value - } else if s.selectedIndex < len(options) { - // the - val = options[s.selectedIndex].Value - } - - // now that we have the value lets go hunt down the right index to return - idx = -1 - for i, optionValue := range s.Options { - if optionValue == val { - idx = i - } + if s.selectedIndex < len(options) { + return options[s.selectedIndex], err } - return core.OptionAnswer{Value: val, Index: idx}, err + return options[0], err } func (s *Select) Cleanup(config *PromptConfig, val interface{}) error { @@ -340,10 +319,11 @@ func (s *Select) Cleanup(config *PromptConfig, val interface{}) error { return s.Render( SelectQuestionTemplate, SelectTemplateData{ - Select: *s, - Answer: val.(core.OptionAnswer).Value, - ShowAnswer: true, - Config: config, + Select: *s, + Answer: val.(core.OptionAnswer).Value, + ShowAnswer: true, + Description: s.Description, + Config: config, }, ) } diff --git a/vendor/github.com/AlecAivazis/survey/v2/survey.go b/vendor/github.com/AlecAivazis/survey/v2/survey.go index 95136ebe..aad73bbe 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/survey.go +++ b/vendor/github.com/AlecAivazis/survey/v2/survey.go @@ -56,8 +56,11 @@ func defaultAskOptions() *AskOptions { // include this option if it matches return strings.Contains(strings.ToLower(value), filter) }, - KeepFilter: false, - ShowCursor: false, + KeepFilter: false, + ShowCursor: false, + RemoveSelectAll: false, + RemoveSelectNone: false, + HideCharacter: '*', }, } } @@ -111,13 +114,16 @@ type Question struct { // PromptConfig holds the global configuration for a prompt type PromptConfig struct { - PageSize int - Icons IconSet - HelpInput string - SuggestInput string - Filter func(filter string, option string, index int) bool - KeepFilter bool - ShowCursor bool + PageSize int + Icons IconSet + HelpInput string + SuggestInput string + Filter func(filter string, option string, index int) bool + KeepFilter bool + ShowCursor bool + RemoveSelectAll bool + RemoveSelectNone bool + HideCharacter rune } // Prompt is the primary interface for the objects that can take user input @@ -175,6 +181,22 @@ func WithKeepFilter(KeepFilter bool) AskOpt { } } +// WithRemoveSelectAll remove the select all option in Multiselect +func WithRemoveSelectAll() AskOpt { + return func(options *AskOptions) error { + options.PromptConfig.RemoveSelectAll = true + return nil + } +} + +// WithRemoveSelectNone remove the select none/unselect all in Multiselect +func WithRemoveSelectNone() AskOpt { + return func(options *AskOptions) error { + options.PromptConfig.RemoveSelectNone = true + return nil + } +} + // WithValidator specifies a validator to use while prompting the user func WithValidator(v Validator) AskOpt { return func(options *AskOptions) error { @@ -234,6 +256,17 @@ func WithShowCursor(ShowCursor bool) AskOpt { } } +// WithHideCharacter sets the default character shown instead of the password for password inputs +func WithHideCharacter(char rune) AskOpt { + return func(options *AskOptions) error { + // set the hide character + options.PromptConfig.HideCharacter = char + + // nothing went wrong + return nil + } +} + /* AskOne performs the prompt for a single prompt and asks for validation if required. Response types should be something that can be casted from the response type designated @@ -245,7 +278,6 @@ in the documentation. For example: } survey.AskOne(prompt, &name) - */ func AskOne(p Prompt, response interface{}, opts ...AskOpt) error { err := Ask([]*Question{{Prompt: p}}, response, opts...) diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/display_posix.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/display_posix.go index 46608087..fbd1b794 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/display_posix.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/display_posix.go @@ -1,3 +1,4 @@ +//go:build !windows // +build !windows package terminal diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/error.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/error.go index 710c3614..55eb6654 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/error.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/error.go @@ -5,5 +5,6 @@ import ( ) var ( + //lint:ignore ST1012 keeping old name for backwards compatibility InterruptErr = errors.New("interrupt") ) diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/output.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/output.go index 6fe11c08..29102420 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/output.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/output.go @@ -1,3 +1,4 @@ +//go:build !windows // +build !windows package terminal diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader.go index e881d753..998e415e 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader.go @@ -377,10 +377,41 @@ func (rr *RuneReader) ReadLineWithDefault(mask rune, d []rune, onRunes ...OnRune } } +// runeWidth returns the number of columns spanned by a rune when printed to the terminal func runeWidth(r rune) int { switch width.LookupRune(r).Kind() { case width.EastAsianWide, width.EastAsianFullwidth: return 2 } + + if !unicode.IsPrint(r) { + return 0 + } return 1 } + +// isAnsiMarker returns if a rune denotes the start of an ANSI sequence +func isAnsiMarker(r rune) bool { + return r == '\x1B' +} + +// isAnsiTerminator returns if a rune denotes the end of an ANSI sequence +func isAnsiTerminator(r rune) bool { + return (r >= 0x40 && r <= 0x5a) || (r == 0x5e) || (r >= 0x60 && r <= 0x7e) +} + +// StringWidth returns the visible width of a string when printed to the terminal +func StringWidth(str string) int { + w := 0 + ansi := false + + for _, r := range str { + // increase width only when outside of ANSI escape sequences + if ansi || isAnsiMarker(r) { + ansi = !isAnsiTerminator(r) + } else { + w += runeWidth(r) + } + } + return w +} diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_bsd.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_bsd.go index 6ea34092..57f10142 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_bsd.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_bsd.go @@ -3,6 +3,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. +//go:build darwin || dragonfly || freebsd || netbsd || openbsd // +build darwin dragonfly freebsd netbsd openbsd package terminal diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_linux.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_linux.go index 6dd60ea6..dc7ec670 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_linux.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_linux.go @@ -2,6 +2,7 @@ // Copyright 2013 The Go Authors. All rights reserved. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. +//go:build linux && !ppc64le // +build linux,!ppc64le package terminal diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_posix.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_posix.go index 3b846049..563a0811 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_posix.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_posix.go @@ -1,3 +1,4 @@ +//go:build !windows // +build !windows // The terminal mode manipulation code is derived heavily from: diff --git a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_ppc64le.go b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_ppc64le.go index ae4eb097..450f796c 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_ppc64le.go +++ b/vendor/github.com/AlecAivazis/survey/v2/terminal/runereader_ppc64le.go @@ -1,3 +1,4 @@ +//go:build ppc64le && linux // +build ppc64le,linux package terminal diff --git a/vendor/github.com/AlecAivazis/survey/v2/transform.go b/vendor/github.com/AlecAivazis/survey/v2/transform.go index 58d5193b..a78ada39 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/transform.go +++ b/vendor/github.com/AlecAivazis/survey/v2/transform.go @@ -3,6 +3,9 @@ package survey import ( "reflect" "strings" + + "golang.org/x/text/cases" + "golang.org/x/text/language" ) // TransformString returns a `Transformer` based on the "f" @@ -62,7 +65,7 @@ func ToLower(ans interface{}) interface{} { // return a nil value, meaning that the above answer // will not be affected by this call at all. func Title(ans interface{}) interface{} { - transformer := TransformString(strings.Title) + transformer := TransformString(cases.Title(language.English).String) return transformer(ans) } diff --git a/vendor/github.com/AlecAivazis/survey/v2/validate.go b/vendor/github.com/AlecAivazis/survey/v2/validate.go index f1961484..7f03b23a 100644 --- a/vendor/github.com/AlecAivazis/survey/v2/validate.go +++ b/vendor/github.com/AlecAivazis/survey/v2/validate.go @@ -15,6 +15,7 @@ func Required(val interface{}) error { // if the value passed in is the zero value of the appropriate type if isZero(value) && value.Kind() != reflect.Bool { + //lint:ignore ST1005 this error message should render as capitalized return errors.New("Value is required") } return nil diff --git a/vendor/golang.org/x/net/AUTHORS b/vendor/golang.org/x/net/AUTHORS deleted file mode 100644 index 15167cd7..00000000 --- a/vendor/golang.org/x/net/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/net/CONTRIBUTORS b/vendor/golang.org/x/net/CONTRIBUTORS deleted file mode 100644 index 1c4577e9..00000000 --- a/vendor/golang.org/x/net/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/net/context/context.go b/vendor/golang.org/x/net/context/context.go index a3c021d3..cf66309c 100644 --- a/vendor/golang.org/x/net/context/context.go +++ b/vendor/golang.org/x/net/context/context.go @@ -21,9 +21,9 @@ // explicitly to each function that needs it. The Context should be the first // parameter, typically named ctx: // -// func DoSomething(ctx context.Context, arg Arg) error { -// // ... use ctx ... -// } +// func DoSomething(ctx context.Context, arg Arg) error { +// // ... use ctx ... +// } // // Do not pass a nil Context, even if a function permits it. Pass context.TODO // if you are unsure about which Context to use. diff --git a/vendor/golang.org/x/net/context/go17.go b/vendor/golang.org/x/net/context/go17.go index 344bd143..0a54bdbc 100644 --- a/vendor/golang.org/x/net/context/go17.go +++ b/vendor/golang.org/x/net/context/go17.go @@ -54,11 +54,11 @@ func WithDeadline(parent Context, deadline time.Time) (Context, CancelFunc) { // Canceling this context releases resources associated with it, so code should // call cancel as soon as the operations running in this Context complete: // -// func slowOperationWithTimeout(ctx context.Context) (Result, error) { -// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) -// defer cancel() // releases resources if slowOperation completes before timeout elapses -// return slowOperation(ctx) -// } +// func slowOperationWithTimeout(ctx context.Context) (Result, error) { +// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) +// defer cancel() // releases resources if slowOperation completes before timeout elapses +// return slowOperation(ctx) +// } func WithTimeout(parent Context, timeout time.Duration) (Context, CancelFunc) { return WithDeadline(parent, time.Now().Add(timeout)) } diff --git a/vendor/golang.org/x/net/context/pre_go17.go b/vendor/golang.org/x/net/context/pre_go17.go index 5270db5d..7b6b6851 100644 --- a/vendor/golang.org/x/net/context/pre_go17.go +++ b/vendor/golang.org/x/net/context/pre_go17.go @@ -264,11 +264,11 @@ func (c *timerCtx) cancel(removeFromParent bool, err error) { // Canceling this context releases resources associated with it, so code should // call cancel as soon as the operations running in this Context complete: // -// func slowOperationWithTimeout(ctx context.Context) (Result, error) { -// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) -// defer cancel() // releases resources if slowOperation completes before timeout elapses -// return slowOperation(ctx) -// } +// func slowOperationWithTimeout(ctx context.Context) (Result, error) { +// ctx, cancel := context.WithTimeout(ctx, 100*time.Millisecond) +// defer cancel() // releases resources if slowOperation completes before timeout elapses +// return slowOperation(ctx) +// } func WithTimeout(parent Context, timeout time.Duration) (Context, CancelFunc) { return WithDeadline(parent, time.Now().Add(timeout)) } diff --git a/vendor/golang.org/x/net/http/httpguts/httplex.go b/vendor/golang.org/x/net/http/httpguts/httplex.go index c79aa73f..6e071e85 100644 --- a/vendor/golang.org/x/net/http/httpguts/httplex.go +++ b/vendor/golang.org/x/net/http/httpguts/httplex.go @@ -173,13 +173,15 @@ func tokenEqual(t1, t2 string) bool { // isLWS reports whether b is linear white space, according // to http://www.w3.org/Protocols/rfc2616/rfc2616-sec2.html#sec2.2 -// LWS = [CRLF] 1*( SP | HT ) +// +// LWS = [CRLF] 1*( SP | HT ) func isLWS(b byte) bool { return b == ' ' || b == '\t' } // isCTL reports whether b is a control byte, according // to http://www.w3.org/Protocols/rfc2616/rfc2616-sec2.html#sec2.2 -// CTL = +// +// CTL = func isCTL(b byte) bool { const del = 0x7f // a CTL return b < ' ' || b == del @@ -189,12 +191,13 @@ func isCTL(b byte) bool { // HTTP/2 imposes the additional restriction that uppercase ASCII // letters are not allowed. // -// RFC 7230 says: -// header-field = field-name ":" OWS field-value OWS -// field-name = token -// token = 1*tchar -// tchar = "!" / "#" / "$" / "%" / "&" / "'" / "*" / "+" / "-" / "." / -// "^" / "_" / "`" / "|" / "~" / DIGIT / ALPHA +// RFC 7230 says: +// +// header-field = field-name ":" OWS field-value OWS +// field-name = token +// token = 1*tchar +// tchar = "!" / "#" / "$" / "%" / "&" / "'" / "*" / "+" / "-" / "." / +// "^" / "_" / "`" / "|" / "~" / DIGIT / ALPHA func ValidHeaderFieldName(v string) bool { if len(v) == 0 { return false @@ -267,27 +270,28 @@ var validHostByte = [256]bool{ // ValidHeaderFieldValue reports whether v is a valid "field-value" according to // http://www.w3.org/Protocols/rfc2616/rfc2616-sec4.html#sec4.2 : // -// message-header = field-name ":" [ field-value ] -// field-value = *( field-content | LWS ) -// field-content = +// message-header = field-name ":" [ field-value ] +// field-value = *( field-content | LWS ) +// field-content = // // http://www.w3.org/Protocols/rfc2616/rfc2616-sec2.html#sec2.2 : // -// TEXT = -// LWS = [CRLF] 1*( SP | HT ) -// CTL = +// TEXT = +// LWS = [CRLF] 1*( SP | HT ) +// CTL = // // RFC 7230 says: -// field-value = *( field-content / obs-fold ) -// obj-fold = N/A to http2, and deprecated -// field-content = field-vchar [ 1*( SP / HTAB ) field-vchar ] -// field-vchar = VCHAR / obs-text -// obs-text = %x80-FF -// VCHAR = "any visible [USASCII] character" +// +// field-value = *( field-content / obs-fold ) +// obj-fold = N/A to http2, and deprecated +// field-content = field-vchar [ 1*( SP / HTAB ) field-vchar ] +// field-vchar = VCHAR / obs-text +// obs-text = %x80-FF +// VCHAR = "any visible [USASCII] character" // // http2 further says: "Similarly, HTTP/2 allows header field values // that are not valid. While most of the values that can be encoded diff --git a/vendor/golang.org/x/net/http2/client_conn_pool.go b/vendor/golang.org/x/net/http2/client_conn_pool.go index c936843e..780968d6 100644 --- a/vendor/golang.org/x/net/http2/client_conn_pool.go +++ b/vendor/golang.org/x/net/http2/client_conn_pool.go @@ -139,7 +139,6 @@ func (p *clientConnPool) getStartDialLocked(ctx context.Context, addr string) *d func (c *dialCall) dial(ctx context.Context, addr string) { const singleUse = false // shared conn c.res, c.err = c.p.t.dialClientConn(ctx, addr, singleUse) - close(c.done) c.p.mu.Lock() delete(c.p.dialing, addr) @@ -147,6 +146,8 @@ func (c *dialCall) dial(ctx context.Context, addr string) { c.p.addConnLocked(addr, c.res) } c.p.mu.Unlock() + + close(c.done) } // addConnIfNeeded makes a NewClientConn out of c if a connection for key doesn't diff --git a/vendor/golang.org/x/net/http2/errors.go b/vendor/golang.org/x/net/http2/errors.go index 2663e5d2..f2067dab 100644 --- a/vendor/golang.org/x/net/http2/errors.go +++ b/vendor/golang.org/x/net/http2/errors.go @@ -136,7 +136,7 @@ func (e headerFieldNameError) Error() string { type headerFieldValueError string func (e headerFieldValueError) Error() string { - return fmt.Sprintf("invalid header field value %q", string(e)) + return fmt.Sprintf("invalid header field value for %q", string(e)) } var ( diff --git a/vendor/golang.org/x/net/http2/frame.go b/vendor/golang.org/x/net/http2/frame.go index 96a74790..0178647e 100644 --- a/vendor/golang.org/x/net/http2/frame.go +++ b/vendor/golang.org/x/net/http2/frame.go @@ -1532,7 +1532,8 @@ func (fr *Framer) readMetaFrame(hf *HeadersFrame) (*MetaHeadersFrame, error) { fr.debugReadLoggerf("http2: decoded hpack field %+v", hf) } if !httpguts.ValidHeaderFieldValue(hf.Value) { - invalid = headerFieldValueError(hf.Value) + // Don't include the value in the error, because it may be sensitive. + invalid = headerFieldValueError(hf.Name) } isPseudo := strings.HasPrefix(hf.Name, ":") if isPseudo { diff --git a/vendor/golang.org/x/net/http2/go118.go b/vendor/golang.org/x/net/http2/go118.go new file mode 100644 index 00000000..aca4b2b3 --- /dev/null +++ b/vendor/golang.org/x/net/http2/go118.go @@ -0,0 +1,17 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.18 +// +build go1.18 + +package http2 + +import ( + "crypto/tls" + "net" +) + +func tlsUnderlyingConn(tc *tls.Conn) net.Conn { + return tc.NetConn() +} diff --git a/vendor/golang.org/x/net/http2/hpack/huffman.go b/vendor/golang.org/x/net/http2/hpack/huffman.go index fe0b84cc..20d083a7 100644 --- a/vendor/golang.org/x/net/http2/hpack/huffman.go +++ b/vendor/golang.org/x/net/http2/hpack/huffman.go @@ -169,25 +169,50 @@ func buildRootHuffmanNode() { // AppendHuffmanString appends s, as encoded in Huffman codes, to dst // and returns the extended buffer. func AppendHuffmanString(dst []byte, s string) []byte { - rembits := uint8(8) - + // This relies on the maximum huffman code length being 30 (See tables.go huffmanCodeLen array) + // So if a uint64 buffer has less than 32 valid bits can always accommodate another huffmanCode. + var ( + x uint64 // buffer + n uint // number valid of bits present in x + ) for i := 0; i < len(s); i++ { - if rembits == 8 { - dst = append(dst, 0) + c := s[i] + n += uint(huffmanCodeLen[c]) + x <<= huffmanCodeLen[c] % 64 + x |= uint64(huffmanCodes[c]) + if n >= 32 { + n %= 32 // Normally would be -= 32 but %= 32 informs compiler 0 <= n <= 31 for upcoming shift + y := uint32(x >> n) // Compiler doesn't combine memory writes if y isn't uint32 + dst = append(dst, byte(y>>24), byte(y>>16), byte(y>>8), byte(y)) } - dst, rembits = appendByteToHuffmanCode(dst, rembits, s[i]) } - - if rembits < 8 { - // special EOS symbol - code := uint32(0x3fffffff) - nbits := uint8(30) - - t := uint8(code >> (nbits - rembits)) - dst[len(dst)-1] |= t + // Add padding bits if necessary + if over := n % 8; over > 0 { + const ( + eosCode = 0x3fffffff + eosNBits = 30 + eosPadByte = eosCode >> (eosNBits - 8) + ) + pad := 8 - over + x = (x << pad) | (eosPadByte >> over) + n += pad // 8 now divides into n exactly } - - return dst + // n in (0, 8, 16, 24, 32) + switch n / 8 { + case 0: + return dst + case 1: + return append(dst, byte(x)) + case 2: + y := uint16(x) + return append(dst, byte(y>>8), byte(y)) + case 3: + y := uint16(x >> 8) + return append(dst, byte(y>>8), byte(y), byte(x)) + } + // case 4: + y := uint32(x) + return append(dst, byte(y>>24), byte(y>>16), byte(y>>8), byte(y)) } // HuffmanEncodeLength returns the number of bytes required to encode @@ -199,35 +224,3 @@ func HuffmanEncodeLength(s string) uint64 { } return (n + 7) / 8 } - -// appendByteToHuffmanCode appends Huffman code for c to dst and -// returns the extended buffer and the remaining bits in the last -// element. The appending is not byte aligned and the remaining bits -// in the last element of dst is given in rembits. -func appendByteToHuffmanCode(dst []byte, rembits uint8, c byte) ([]byte, uint8) { - code := huffmanCodes[c] - nbits := huffmanCodeLen[c] - - for { - if rembits > nbits { - t := uint8(code << (rembits - nbits)) - dst[len(dst)-1] |= t - rembits -= nbits - break - } - - t := uint8(code >> (nbits - rembits)) - dst[len(dst)-1] |= t - - nbits -= rembits - rembits = 8 - - if nbits == 0 { - break - } - - dst = append(dst, 0) - } - - return dst, rembits -} diff --git a/vendor/golang.org/x/net/http2/http2.go b/vendor/golang.org/x/net/http2/http2.go index 5571ccfd..479ba4b2 100644 --- a/vendor/golang.org/x/net/http2/http2.go +++ b/vendor/golang.org/x/net/http2/http2.go @@ -13,7 +13,6 @@ // See https://http2.github.io/ for more information on HTTP/2. // // See https://http2.golang.org/ for a test server running this code. -// package http2 // import "golang.org/x/net/http2" import ( @@ -176,10 +175,11 @@ func (s SettingID) String() string { // name (key). See httpguts.ValidHeaderName for the base rules. // // Further, http2 says: -// "Just as in HTTP/1.x, header field names are strings of ASCII -// characters that are compared in a case-insensitive -// fashion. However, header field names MUST be converted to -// lowercase prior to their encoding in HTTP/2. " +// +// "Just as in HTTP/1.x, header field names are strings of ASCII +// characters that are compared in a case-insensitive +// fashion. However, header field names MUST be converted to +// lowercase prior to their encoding in HTTP/2. " func validWireHeaderFieldName(v string) bool { if len(v) == 0 { return false @@ -365,8 +365,8 @@ func (s *sorter) SortStrings(ss []string) { // validPseudoPath reports whether v is a valid :path pseudo-header // value. It must be either: // -// *) a non-empty string starting with '/' -// *) the string '*', for OPTIONS requests. +// - a non-empty string starting with '/' +// - the string '*', for OPTIONS requests. // // For now this is only used a quick check for deciding when to clean // up Opaque URLs before sending requests from the Transport. diff --git a/vendor/golang.org/x/net/http2/not_go118.go b/vendor/golang.org/x/net/http2/not_go118.go new file mode 100644 index 00000000..eab532c9 --- /dev/null +++ b/vendor/golang.org/x/net/http2/not_go118.go @@ -0,0 +1,17 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.18 +// +build !go1.18 + +package http2 + +import ( + "crypto/tls" + "net" +) + +func tlsUnderlyingConn(tc *tls.Conn) net.Conn { + return nil +} diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index e644d9b2..47524a61 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -315,6 +315,20 @@ type ServeConnOpts struct { // requests. If nil, BaseConfig.Handler is used. If BaseConfig // or BaseConfig.Handler is nil, http.DefaultServeMux is used. Handler http.Handler + + // UpgradeRequest is an initial request received on a connection + // undergoing an h2c upgrade. The request body must have been + // completely read from the connection before calling ServeConn, + // and the 101 Switching Protocols response written. + UpgradeRequest *http.Request + + // Settings is the decoded contents of the HTTP2-Settings header + // in an h2c upgrade request. + Settings []byte + + // SawClientPreface is set if the HTTP/2 connection preface + // has already been read from the connection. + SawClientPreface bool } func (o *ServeConnOpts) context() context.Context { @@ -383,6 +397,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { headerTableSize: initialHeaderTableSize, serveG: newGoroutineLock(), pushEnabled: true, + sawClientPreface: opts.SawClientPreface, } s.state.registerConn(sc) @@ -400,7 +415,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { if s.NewWriteScheduler != nil { sc.writeSched = s.NewWriteScheduler() } else { - sc.writeSched = NewRandomWriteScheduler() + sc.writeSched = NewPriorityWriteScheduler(nil) } // These start at the RFC-specified defaults. If there is a higher @@ -465,9 +480,27 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { } } + if opts.Settings != nil { + fr := &SettingsFrame{ + FrameHeader: FrameHeader{valid: true}, + p: opts.Settings, + } + if err := fr.ForeachSetting(sc.processSetting); err != nil { + sc.rejectConn(ErrCodeProtocol, "invalid settings") + return + } + opts.Settings = nil + } + if hook := testHookGetServerConn; hook != nil { hook(sc) } + + if opts.UpgradeRequest != nil { + sc.upgradeRequest(opts.UpgradeRequest) + opts.UpgradeRequest = nil + } + sc.serve() } @@ -512,6 +545,7 @@ type serverConn struct { // Everything following is owned by the serve loop; use serveG.check(): serveG goroutineLock // used to verify funcs are on serve() pushEnabled bool + sawClientPreface bool // preface has already been read, used in h2c upgrade sawFirstSettings bool // got the initial SETTINGS frame after the preface needToSendSettingsAck bool unackedSettings int // how many SETTINGS have we sent without ACKs? @@ -974,6 +1008,9 @@ var errPrefaceTimeout = errors.New("timeout waiting for client preface") // returns errPrefaceTimeout on timeout, or an error if the greeting // is invalid. func (sc *serverConn) readPreface() error { + if sc.sawClientPreface { + return nil + } errc := make(chan error, 1) go func() { // Read the client preface @@ -1915,6 +1952,26 @@ func (sc *serverConn) processHeaders(f *MetaHeadersFrame) error { return nil } +func (sc *serverConn) upgradeRequest(req *http.Request) { + sc.serveG.check() + id := uint32(1) + sc.maxClientStreamID = id + st := sc.newStream(id, 0, stateHalfClosedRemote) + st.reqTrailer = req.Trailer + if st.reqTrailer != nil { + st.trailer = make(http.Header) + } + rw := sc.newResponseWriter(st, req) + + // Disable any read deadline set by the net/http package + // prior to the upgrade. + if sc.hs.ReadTimeout != 0 { + sc.conn.SetReadDeadline(time.Time{}) + } + + go sc.runHandler(rw, req, sc.handler.ServeHTTP) +} + func (st *stream) processTrailerHeaders(f *MetaHeadersFrame) error { sc := st.sc sc.serveG.check() @@ -2145,6 +2202,11 @@ func (sc *serverConn) newWriterAndRequestNoBody(st *stream, rp requestParam) (*r } req = req.WithContext(st.ctx) + rw := sc.newResponseWriter(st, req) + return rw, req, nil +} + +func (sc *serverConn) newResponseWriter(st *stream, req *http.Request) *responseWriter { rws := responseWriterStatePool.Get().(*responseWriterState) bwSave := rws.bw *rws = responseWriterState{} // zero all the fields @@ -2153,10 +2215,7 @@ func (sc *serverConn) newWriterAndRequestNoBody(st *stream, rp requestParam) (*r rws.bw.Reset(chunkWriter{rws}) rws.stream = st rws.req = req - rws.body = body - - rw := &responseWriter{rws: rws} - return rw, req, nil + return &responseWriter{rws: rws} } // Run on its own goroutine. @@ -2316,17 +2375,18 @@ type requestBody struct { _ incomparable stream *stream conn *serverConn - closed bool // for use by Close only - sawEOF bool // for use by Read only - pipe *pipe // non-nil if we have a HTTP entity message body - needsContinue bool // need to send a 100-continue + closeOnce sync.Once // for use by Close only + sawEOF bool // for use by Read only + pipe *pipe // non-nil if we have a HTTP entity message body + needsContinue bool // need to send a 100-continue } func (b *requestBody) Close() error { - if b.pipe != nil && !b.closed { - b.pipe.BreakWithError(errClosedBody) - } - b.closed = true + b.closeOnce.Do(func() { + if b.pipe != nil { + b.pipe.BreakWithError(errClosedBody) + } + }) return nil } @@ -2370,7 +2430,6 @@ type responseWriterState struct { // immutable within a request: stream *stream req *http.Request - body *requestBody // to close at end of request, if DATA frames didn't conn *serverConn // TODO: adjust buffer writing sizes based on server config, frame size updates from peer, etc @@ -2546,8 +2605,9 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { // prior to the headers being written. If the set of trailers is fixed // or known before the header is written, the normal Go trailers mechanism // is preferred: -// https://golang.org/pkg/net/http/#ResponseWriter -// https://golang.org/pkg/net/http/#example_ResponseWriter_trailers +// +// https://golang.org/pkg/net/http/#ResponseWriter +// https://golang.org/pkg/net/http/#example_ResponseWriter_trailers const TrailerPrefix = "Trailer:" // promoteUndeclaredTrailers permits http.Handlers to set trailers @@ -2643,8 +2703,7 @@ func checkWriteHeaderCode(code int) { // Issue 22880: require valid WriteHeader status codes. // For now we only enforce that it's three digits. // In the future we might block things over 599 (600 and above aren't defined - // at http://httpwg.org/specs/rfc7231.html#status.codes) - // and we might block under 200 (once we have more mature 1xx support). + // at http://httpwg.org/specs/rfc7231.html#status.codes). // But for now any three digits. // // We used to send "HTTP/1.1 000 0" on the wire in responses but there's @@ -2665,13 +2724,41 @@ func (w *responseWriter) WriteHeader(code int) { } func (rws *responseWriterState) writeHeader(code int) { - if !rws.wroteHeader { - checkWriteHeaderCode(code) - rws.wroteHeader = true - rws.status = code - if len(rws.handlerHeader) > 0 { - rws.snapHeader = cloneHeader(rws.handlerHeader) + if rws.wroteHeader { + return + } + + checkWriteHeaderCode(code) + + // Handle informational headers + if code >= 100 && code <= 199 { + // Per RFC 8297 we must not clear the current header map + h := rws.handlerHeader + + _, cl := h["Content-Length"] + _, te := h["Transfer-Encoding"] + if cl || te { + h = h.Clone() + h.Del("Content-Length") + h.Del("Transfer-Encoding") + } + + if rws.conn.writeHeaders(rws.stream, &writeResHeaders{ + streamID: rws.stream.id, + httpResCode: code, + h: h, + endStream: rws.handlerDone && !rws.hasTrailers(), + }) != nil { + rws.dirty = true } + + return + } + + rws.wroteHeader = true + rws.status = code + if len(rws.handlerHeader) > 0 { + rws.snapHeader = cloneHeader(rws.handlerHeader) } } diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index f135b0f7..4ded4dfd 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -16,7 +16,6 @@ import ( "errors" "fmt" "io" - "io/ioutil" "log" "math" mathrand "math/rand" @@ -501,12 +500,14 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res if req, err = shouldRetryRequest(req, err); err == nil { // After the first retry, do exponential backoff with 10% jitter. if retry == 0 { + t.vlogf("RoundTrip retrying after failure: %v", err) continue } backoff := float64(uint(1) << (uint(retry) - 1)) backoff += backoff * (0.1 * mathrand.Float64()) select { case <-time.After(time.Second * time.Duration(backoff)): + t.vlogf("RoundTrip retrying after failure: %v", err) continue case <-req.Context().Done(): err = req.Context().Err() @@ -732,11 +733,13 @@ func (cc *ClientConn) healthCheck() { // trigger the healthCheck again if there is no frame received. ctx, cancel := context.WithTimeout(context.Background(), pingTimeout) defer cancel() + cc.vlogf("http2: Transport sending health check") err := cc.Ping(ctx) if err != nil { + cc.vlogf("http2: Transport health check failure: %v", err) cc.closeForLostPing() - cc.t.connPool().MarkDead(cc) - return + } else { + cc.vlogf("http2: Transport health check success") } } @@ -907,6 +910,24 @@ func (cc *ClientConn) onIdleTimeout() { cc.closeIfIdle() } +func (cc *ClientConn) closeConn() error { + t := time.AfterFunc(250*time.Millisecond, cc.forceCloseConn) + defer t.Stop() + return cc.tconn.Close() +} + +// A tls.Conn.Close can hang for a long time if the peer is unresponsive. +// Try to shut it down more aggressively. +func (cc *ClientConn) forceCloseConn() { + tc, ok := cc.tconn.(*tls.Conn) + if !ok { + return + } + if nc := tlsUnderlyingConn(tc); nc != nil { + nc.Close() + } +} + func (cc *ClientConn) closeIfIdle() { cc.mu.Lock() if len(cc.streams) > 0 || cc.streamsReserved > 0 { @@ -921,7 +942,7 @@ func (cc *ClientConn) closeIfIdle() { if VerboseLogs { cc.vlogf("http2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)", cc, cc.singleUse, nextID-2) } - cc.tconn.Close() + cc.closeConn() } func (cc *ClientConn) isDoNotReuseAndIdle() bool { @@ -938,7 +959,7 @@ func (cc *ClientConn) Shutdown(ctx context.Context) error { return err } // Wait for all in-flight streams to complete or connection to close - done := make(chan error, 1) + done := make(chan struct{}) cancelled := false // guarded by cc.mu go func() { cc.mu.Lock() @@ -946,7 +967,7 @@ func (cc *ClientConn) Shutdown(ctx context.Context) error { for { if len(cc.streams) == 0 || cc.closed { cc.closed = true - done <- cc.tconn.Close() + close(done) break } if cancelled { @@ -957,8 +978,8 @@ func (cc *ClientConn) Shutdown(ctx context.Context) error { }() shutdownEnterWaitStateHook() select { - case err := <-done: - return err + case <-done: + return cc.closeConn() case <-ctx.Done(): cc.mu.Lock() // Free the goroutine above @@ -1001,9 +1022,9 @@ func (cc *ClientConn) closeForError(err error) error { for _, cs := range cc.streams { cs.abortStreamLocked(err) } - defer cc.cond.Broadcast() - defer cc.mu.Unlock() - return cc.tconn.Close() + cc.cond.Broadcast() + cc.mu.Unlock() + return cc.closeConn() } // Close closes the client connection immediately. @@ -1748,7 +1769,8 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail } for _, v := range vv { if !httpguts.ValidHeaderFieldValue(v) { - return nil, fmt.Errorf("invalid HTTP header value %q for header %q", v, k) + // Don't include the value in the error, because it may be sensitive. + return nil, fmt.Errorf("invalid HTTP header value for header %q", k) } } } @@ -1978,7 +2000,7 @@ func (cc *ClientConn) forgetStreamID(id uint32) { cc.vlogf("http2: Transport closing idle conn %p (forSingleUse=%v, maxStream=%v)", cc, cc.singleUse, cc.nextStreamID-2) } cc.closed = true - defer cc.tconn.Close() + defer cc.closeConn() } cc.mu.Unlock() @@ -2025,8 +2047,8 @@ func isEOFOrNetReadError(err error) bool { func (rl *clientConnReadLoop) cleanup() { cc := rl.cc - defer cc.tconn.Close() - defer cc.t.connPool().MarkDead(cc) + cc.t.connPool().MarkDead(cc) + defer cc.closeConn() defer close(cc.readerDone) if cc.idleTimer != nil { @@ -2881,7 +2903,12 @@ func (t *Transport) logf(format string, args ...interface{}) { log.Printf(format, args...) } -var noBody io.ReadCloser = ioutil.NopCloser(bytes.NewReader(nil)) +var noBody io.ReadCloser = noBodyReader{} + +type noBodyReader struct{} + +func (noBodyReader) Close() error { return nil } +func (noBodyReader) Read([]byte) (int, error) { return 0, io.EOF } type missingBody struct{} diff --git a/vendor/golang.org/x/net/http2/writesched_priority.go b/vendor/golang.org/x/net/http2/writesched_priority.go index 2618b2c1..0a242c66 100644 --- a/vendor/golang.org/x/net/http2/writesched_priority.go +++ b/vendor/golang.org/x/net/http2/writesched_priority.go @@ -383,16 +383,15 @@ func (ws *priorityWriteScheduler) AdjustStream(streamID uint32, priority Priorit func (ws *priorityWriteScheduler) Push(wr FrameWriteRequest) { var n *priorityNode - if id := wr.StreamID(); id == 0 { + if wr.isControl() { n = &ws.root } else { + id := wr.StreamID() n = ws.nodes[id] if n == nil { // id is an idle or closed stream. wr should not be a HEADERS or - // DATA frame. However, wr can be a RST_STREAM. In this case, we - // push wr onto the root, rather than creating a new priorityNode, - // since RST_STREAM is tiny and the stream's priority is unknown - // anyway. See issue #17919. + // DATA frame. In other case, we push wr onto the root, rather + // than creating a new priorityNode. if wr.DataSize() > 0 { panic("add DATA on non-open stream") } diff --git a/vendor/golang.org/x/net/idna/trieval.go b/vendor/golang.org/x/net/idna/trieval.go index 7a8cf889..9c070a44 100644 --- a/vendor/golang.org/x/net/idna/trieval.go +++ b/vendor/golang.org/x/net/idna/trieval.go @@ -17,23 +17,23 @@ package idna // // The per-rune values have the following format: // -// if mapped { -// if inlinedXOR { -// 15..13 inline XOR marker -// 12..11 unused -// 10..3 inline XOR mask -// } else { -// 15..3 index into xor or mapping table -// } -// } else { -// 15..14 unused -// 13 mayNeedNorm -// 12..11 attributes -// 10..8 joining type -// 7..3 category type -// } -// 2 use xor pattern -// 1..0 mapped category +// if mapped { +// if inlinedXOR { +// 15..13 inline XOR marker +// 12..11 unused +// 10..3 inline XOR mask +// } else { +// 15..3 index into xor or mapping table +// } +// } else { +// 15..14 unused +// 13 mayNeedNorm +// 12..11 attributes +// 10..8 joining type +// 7..3 category type +// } +// 2 use xor pattern +// 1..0 mapped category // // See the definitions below for a more detailed description of the various // bits. diff --git a/vendor/golang.org/x/sys/AUTHORS b/vendor/golang.org/x/sys/AUTHORS deleted file mode 100644 index 15167cd7..00000000 --- a/vendor/golang.org/x/sys/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/sys/CONTRIBUTORS b/vendor/golang.org/x/sys/CONTRIBUTORS deleted file mode 100644 index 1c4577e9..00000000 --- a/vendor/golang.org/x/sys/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/sys/plan9/syscall.go b/vendor/golang.org/x/sys/plan9/syscall.go index 602473cb..a25223b8 100644 --- a/vendor/golang.org/x/sys/plan9/syscall.go +++ b/vendor/golang.org/x/sys/plan9/syscall.go @@ -113,5 +113,6 @@ func (tv *Timeval) Nano() int64 { // use is a no-op, but the compiler cannot see that it is. // Calling use(p) ensures that p is kept live until that point. +// //go:noescape func use(p unsafe.Pointer) diff --git a/vendor/golang.org/x/sys/plan9/syscall_plan9.go b/vendor/golang.org/x/sys/plan9/syscall_plan9.go index 723b1f40..d079d811 100644 --- a/vendor/golang.org/x/sys/plan9/syscall_plan9.go +++ b/vendor/golang.org/x/sys/plan9/syscall_plan9.go @@ -115,6 +115,7 @@ func Write(fd int, p []byte) (n int, err error) { var ioSync int64 //sys fd2path(fd int, buf []byte) (err error) + func Fd2path(fd int) (path string, err error) { var buf [512]byte @@ -126,6 +127,7 @@ func Fd2path(fd int) (path string, err error) { } //sys pipe(p *[2]int32) (err error) + func Pipe(p []int) (err error) { if len(p) != 2 { return syscall.ErrorString("bad arg in system call") @@ -180,6 +182,7 @@ func (w Waitmsg) ExitStatus() int { } //sys await(s []byte) (n int, err error) + func Await(w *Waitmsg) (err error) { var buf [512]byte var f [5][]byte @@ -301,42 +304,49 @@ func Getgroups() (gids []int, err error) { } //sys open(path string, mode int) (fd int, err error) + func Open(path string, mode int) (fd int, err error) { fixwd() return open(path, mode) } //sys create(path string, mode int, perm uint32) (fd int, err error) + func Create(path string, mode int, perm uint32) (fd int, err error) { fixwd() return create(path, mode, perm) } //sys remove(path string) (err error) + func Remove(path string) error { fixwd() return remove(path) } //sys stat(path string, edir []byte) (n int, err error) + func Stat(path string, edir []byte) (n int, err error) { fixwd() return stat(path, edir) } //sys bind(name string, old string, flag int) (err error) + func Bind(name string, old string, flag int) (err error) { fixwd() return bind(name, old, flag) } //sys mount(fd int, afd int, old string, flag int, aname string) (err error) + func Mount(fd int, afd int, old string, flag int, aname string) (err error) { fixwd() return mount(fd, afd, old, flag, aname) } //sys wstat(path string, edir []byte) (err error) + func Wstat(path string, edir []byte) (err error) { fixwd() return wstat(path, edir) diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s new file mode 100644 index 00000000..d560019e --- /dev/null +++ b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s @@ -0,0 +1,29 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (darwin || freebsd || netbsd || openbsd) && gc +// +build darwin freebsd netbsd openbsd +// +build gc + +#include "textflag.h" + +// System call support for RISCV64 BSD + +// Just jump to package syscall's implementation for all these functions. +// The runtime may know about them. + +TEXT ·Syscall(SB),NOSPLIT,$0-56 + JMP syscall·Syscall(SB) + +TEXT ·Syscall6(SB),NOSPLIT,$0-80 + JMP syscall·Syscall6(SB) + +TEXT ·Syscall9(SB),NOSPLIT,$0-104 + JMP syscall·Syscall9(SB) + +TEXT ·RawSyscall(SB),NOSPLIT,$0-56 + JMP syscall·RawSyscall(SB) + +TEXT ·RawSyscall6(SB),NOSPLIT,$0-80 + JMP syscall·RawSyscall6(SB) diff --git a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s new file mode 100644 index 00000000..56535728 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s @@ -0,0 +1,54 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux && loong64 && gc +// +build linux +// +build loong64 +// +build gc + +#include "textflag.h" + + +// Just jump to package syscall's implementation for all these functions. +// The runtime may know about them. + +TEXT ·Syscall(SB),NOSPLIT,$0-56 + JMP syscall·Syscall(SB) + +TEXT ·Syscall6(SB),NOSPLIT,$0-80 + JMP syscall·Syscall6(SB) + +TEXT ·SyscallNoError(SB),NOSPLIT,$0-48 + JAL runtime·entersyscall(SB) + MOVV a1+8(FP), R4 + MOVV a2+16(FP), R5 + MOVV a3+24(FP), R6 + MOVV R0, R7 + MOVV R0, R8 + MOVV R0, R9 + MOVV trap+0(FP), R11 // syscall entry + SYSCALL + MOVV R4, r1+32(FP) + MOVV R0, r2+40(FP) // r2 is not used. Always set to 0 + JAL runtime·exitsyscall(SB) + RET + +TEXT ·RawSyscall(SB),NOSPLIT,$0-56 + JMP syscall·RawSyscall(SB) + +TEXT ·RawSyscall6(SB),NOSPLIT,$0-80 + JMP syscall·RawSyscall6(SB) + +TEXT ·RawSyscallNoError(SB),NOSPLIT,$0-48 + MOVV a1+8(FP), R4 + MOVV a2+16(FP), R5 + MOVV a3+24(FP), R6 + MOVV R0, R7 + MOVV R0, R8 + MOVV R0, R9 + MOVV trap+0(FP), R11 // syscall entry + SYSCALL + MOVV R4, r1+32(FP) + MOVV R0, r2+40(FP) // r2 is not used. Always set to 0 + RET diff --git a/vendor/golang.org/x/sys/unix/endian_little.go b/vendor/golang.org/x/sys/unix/endian_little.go index 4362f47e..b0f2bc4a 100644 --- a/vendor/golang.org/x/sys/unix/endian_little.go +++ b/vendor/golang.org/x/sys/unix/endian_little.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. // -//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh +//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh +// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh package unix diff --git a/vendor/golang.org/x/sys/unix/errors_freebsd_386.go b/vendor/golang.org/x/sys/unix/errors_freebsd_386.go deleted file mode 100644 index 761db66e..00000000 --- a/vendor/golang.org/x/sys/unix/errors_freebsd_386.go +++ /dev/null @@ -1,233 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Constants that were deprecated or moved to enums in the FreeBSD headers. Keep -// them here for backwards compatibility. - -package unix - -const ( - DLT_HHDLC = 0x79 - IFF_SMART = 0x20 - IFT_1822 = 0x2 - IFT_A12MPPSWITCH = 0x82 - IFT_AAL2 = 0xbb - IFT_AAL5 = 0x31 - IFT_ADSL = 0x5e - IFT_AFLANE8023 = 0x3b - IFT_AFLANE8025 = 0x3c - IFT_ARAP = 0x58 - IFT_ARCNET = 0x23 - IFT_ARCNETPLUS = 0x24 - IFT_ASYNC = 0x54 - IFT_ATM = 0x25 - IFT_ATMDXI = 0x69 - IFT_ATMFUNI = 0x6a - IFT_ATMIMA = 0x6b - IFT_ATMLOGICAL = 0x50 - IFT_ATMRADIO = 0xbd - IFT_ATMSUBINTERFACE = 0x86 - IFT_ATMVCIENDPT = 0xc2 - IFT_ATMVIRTUAL = 0x95 - IFT_BGPPOLICYACCOUNTING = 0xa2 - IFT_BSC = 0x53 - IFT_CCTEMUL = 0x3d - IFT_CEPT = 0x13 - IFT_CES = 0x85 - IFT_CHANNEL = 0x46 - IFT_CNR = 0x55 - IFT_COFFEE = 0x84 - IFT_COMPOSITELINK = 0x9b - IFT_DCN = 0x8d - IFT_DIGITALPOWERLINE = 0x8a - IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba - IFT_DLSW = 0x4a - IFT_DOCSCABLEDOWNSTREAM = 0x80 - IFT_DOCSCABLEMACLAYER = 0x7f - IFT_DOCSCABLEUPSTREAM = 0x81 - IFT_DS0 = 0x51 - IFT_DS0BUNDLE = 0x52 - IFT_DS1FDL = 0xaa - IFT_DS3 = 0x1e - IFT_DTM = 0x8c - IFT_DVBASILN = 0xac - IFT_DVBASIOUT = 0xad - IFT_DVBRCCDOWNSTREAM = 0x93 - IFT_DVBRCCMACLAYER = 0x92 - IFT_DVBRCCUPSTREAM = 0x94 - IFT_ENC = 0xf4 - IFT_EON = 0x19 - IFT_EPLRS = 0x57 - IFT_ESCON = 0x49 - IFT_ETHER = 0x6 - IFT_FAITH = 0xf2 - IFT_FAST = 0x7d - IFT_FASTETHER = 0x3e - IFT_FASTETHERFX = 0x45 - IFT_FDDI = 0xf - IFT_FIBRECHANNEL = 0x38 - IFT_FRAMERELAYINTERCONNECT = 0x3a - IFT_FRAMERELAYMPI = 0x5c - IFT_FRDLCIENDPT = 0xc1 - IFT_FRELAY = 0x20 - IFT_FRELAYDCE = 0x2c - IFT_FRF16MFRBUNDLE = 0xa3 - IFT_FRFORWARD = 0x9e - IFT_G703AT2MB = 0x43 - IFT_G703AT64K = 0x42 - IFT_GIF = 0xf0 - IFT_GIGABITETHERNET = 0x75 - IFT_GR303IDT = 0xb2 - IFT_GR303RDT = 0xb1 - IFT_H323GATEKEEPER = 0xa4 - IFT_H323PROXY = 0xa5 - IFT_HDH1822 = 0x3 - IFT_HDLC = 0x76 - IFT_HDSL2 = 0xa8 - IFT_HIPERLAN2 = 0xb7 - IFT_HIPPI = 0x2f - IFT_HIPPIINTERFACE = 0x39 - IFT_HOSTPAD = 0x5a - IFT_HSSI = 0x2e - IFT_HY = 0xe - IFT_IBM370PARCHAN = 0x48 - IFT_IDSL = 0x9a - IFT_IEEE80211 = 0x47 - IFT_IEEE80212 = 0x37 - IFT_IEEE8023ADLAG = 0xa1 - IFT_IFGSN = 0x91 - IFT_IMT = 0xbe - IFT_INTERLEAVE = 0x7c - IFT_IP = 0x7e - IFT_IPFORWARD = 0x8e - IFT_IPOVERATM = 0x72 - IFT_IPOVERCDLC = 0x6d - IFT_IPOVERCLAW = 0x6e - IFT_IPSWITCH = 0x4e - IFT_IPXIP = 0xf9 - IFT_ISDN = 0x3f - IFT_ISDNBASIC = 0x14 - IFT_ISDNPRIMARY = 0x15 - IFT_ISDNS = 0x4b - IFT_ISDNU = 0x4c - IFT_ISO88022LLC = 0x29 - IFT_ISO88023 = 0x7 - IFT_ISO88024 = 0x8 - IFT_ISO88025 = 0x9 - IFT_ISO88025CRFPINT = 0x62 - IFT_ISO88025DTR = 0x56 - IFT_ISO88025FIBER = 0x73 - IFT_ISO88026 = 0xa - IFT_ISUP = 0xb3 - IFT_L3IPXVLAN = 0x89 - IFT_LAPB = 0x10 - IFT_LAPD = 0x4d - IFT_LAPF = 0x77 - IFT_LOCALTALK = 0x2a - IFT_LOOP = 0x18 - IFT_MEDIAMAILOVERIP = 0x8b - IFT_MFSIGLINK = 0xa7 - IFT_MIOX25 = 0x26 - IFT_MODEM = 0x30 - IFT_MPC = 0x71 - IFT_MPLS = 0xa6 - IFT_MPLSTUNNEL = 0x96 - IFT_MSDSL = 0x8f - IFT_MVL = 0xbf - IFT_MYRINET = 0x63 - IFT_NFAS = 0xaf - IFT_NSIP = 0x1b - IFT_OPTICALCHANNEL = 0xc3 - IFT_OPTICALTRANSPORT = 0xc4 - IFT_OTHER = 0x1 - IFT_P10 = 0xc - IFT_P80 = 0xd - IFT_PARA = 0x22 - IFT_PFLOG = 0xf6 - IFT_PFSYNC = 0xf7 - IFT_PLC = 0xae - IFT_POS = 0xab - IFT_PPPMULTILINKBUNDLE = 0x6c - IFT_PROPBWAP2MP = 0xb8 - IFT_PROPCNLS = 0x59 - IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 - IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 - IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 - IFT_PROPMUX = 0x36 - IFT_PROPWIRELESSP2P = 0x9d - IFT_PTPSERIAL = 0x16 - IFT_PVC = 0xf1 - IFT_QLLC = 0x44 - IFT_RADIOMAC = 0xbc - IFT_RADSL = 0x5f - IFT_REACHDSL = 0xc0 - IFT_RFC1483 = 0x9f - IFT_RS232 = 0x21 - IFT_RSRB = 0x4f - IFT_SDLC = 0x11 - IFT_SDSL = 0x60 - IFT_SHDSL = 0xa9 - IFT_SIP = 0x1f - IFT_SLIP = 0x1c - IFT_SMDSDXI = 0x2b - IFT_SMDSICIP = 0x34 - IFT_SONET = 0x27 - IFT_SONETOVERHEADCHANNEL = 0xb9 - IFT_SONETPATH = 0x32 - IFT_SONETVT = 0x33 - IFT_SRP = 0x97 - IFT_SS7SIGLINK = 0x9c - IFT_STACKTOSTACK = 0x6f - IFT_STARLAN = 0xb - IFT_STF = 0xd7 - IFT_T1 = 0x12 - IFT_TDLC = 0x74 - IFT_TERMPAD = 0x5b - IFT_TR008 = 0xb0 - IFT_TRANSPHDLC = 0x7b - IFT_TUNNEL = 0x83 - IFT_ULTRA = 0x1d - IFT_USB = 0xa0 - IFT_V11 = 0x40 - IFT_V35 = 0x2d - IFT_V36 = 0x41 - IFT_V37 = 0x78 - IFT_VDSL = 0x61 - IFT_VIRTUALIPADDRESS = 0x70 - IFT_VOICEEM = 0x64 - IFT_VOICEENCAP = 0x67 - IFT_VOICEFXO = 0x65 - IFT_VOICEFXS = 0x66 - IFT_VOICEOVERATM = 0x98 - IFT_VOICEOVERFRAMERELAY = 0x99 - IFT_VOICEOVERIP = 0x68 - IFT_X213 = 0x5d - IFT_X25 = 0x5 - IFT_X25DDN = 0x4 - IFT_X25HUNTGROUP = 0x7a - IFT_X25MLP = 0x79 - IFT_X25PLE = 0x28 - IFT_XETHER = 0x1a - IPPROTO_MAXID = 0x34 - IPV6_FAITH = 0x1d - IPV6_MIN_MEMBERSHIPS = 0x1f - IP_FAITH = 0x16 - IP_MAX_SOURCE_FILTER = 0x400 - IP_MIN_MEMBERSHIPS = 0x1f - MAP_NORESERVE = 0x40 - MAP_RENAME = 0x20 - NET_RT_MAXID = 0x6 - RTF_PRCLONING = 0x10000 - RTM_OLDADD = 0x9 - RTM_OLDDEL = 0xa - RT_CACHING_CONTEXT = 0x1 - RT_NORTREF = 0x2 - SIOCADDRT = 0x8030720a - SIOCALIFADDR = 0x8118691b - SIOCDELRT = 0x8030720b - SIOCDLIFADDR = 0x8118691d - SIOCGLIFADDR = 0xc118691c - SIOCGLIFPHYADDR = 0xc118694b - SIOCSLIFPHYADDR = 0x8118694a -) diff --git a/vendor/golang.org/x/sys/unix/errors_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/errors_freebsd_amd64.go deleted file mode 100644 index 070f44b6..00000000 --- a/vendor/golang.org/x/sys/unix/errors_freebsd_amd64.go +++ /dev/null @@ -1,233 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Constants that were deprecated or moved to enums in the FreeBSD headers. Keep -// them here for backwards compatibility. - -package unix - -const ( - DLT_HHDLC = 0x79 - IFF_SMART = 0x20 - IFT_1822 = 0x2 - IFT_A12MPPSWITCH = 0x82 - IFT_AAL2 = 0xbb - IFT_AAL5 = 0x31 - IFT_ADSL = 0x5e - IFT_AFLANE8023 = 0x3b - IFT_AFLANE8025 = 0x3c - IFT_ARAP = 0x58 - IFT_ARCNET = 0x23 - IFT_ARCNETPLUS = 0x24 - IFT_ASYNC = 0x54 - IFT_ATM = 0x25 - IFT_ATMDXI = 0x69 - IFT_ATMFUNI = 0x6a - IFT_ATMIMA = 0x6b - IFT_ATMLOGICAL = 0x50 - IFT_ATMRADIO = 0xbd - IFT_ATMSUBINTERFACE = 0x86 - IFT_ATMVCIENDPT = 0xc2 - IFT_ATMVIRTUAL = 0x95 - IFT_BGPPOLICYACCOUNTING = 0xa2 - IFT_BSC = 0x53 - IFT_CCTEMUL = 0x3d - IFT_CEPT = 0x13 - IFT_CES = 0x85 - IFT_CHANNEL = 0x46 - IFT_CNR = 0x55 - IFT_COFFEE = 0x84 - IFT_COMPOSITELINK = 0x9b - IFT_DCN = 0x8d - IFT_DIGITALPOWERLINE = 0x8a - IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba - IFT_DLSW = 0x4a - IFT_DOCSCABLEDOWNSTREAM = 0x80 - IFT_DOCSCABLEMACLAYER = 0x7f - IFT_DOCSCABLEUPSTREAM = 0x81 - IFT_DS0 = 0x51 - IFT_DS0BUNDLE = 0x52 - IFT_DS1FDL = 0xaa - IFT_DS3 = 0x1e - IFT_DTM = 0x8c - IFT_DVBASILN = 0xac - IFT_DVBASIOUT = 0xad - IFT_DVBRCCDOWNSTREAM = 0x93 - IFT_DVBRCCMACLAYER = 0x92 - IFT_DVBRCCUPSTREAM = 0x94 - IFT_ENC = 0xf4 - IFT_EON = 0x19 - IFT_EPLRS = 0x57 - IFT_ESCON = 0x49 - IFT_ETHER = 0x6 - IFT_FAITH = 0xf2 - IFT_FAST = 0x7d - IFT_FASTETHER = 0x3e - IFT_FASTETHERFX = 0x45 - IFT_FDDI = 0xf - IFT_FIBRECHANNEL = 0x38 - IFT_FRAMERELAYINTERCONNECT = 0x3a - IFT_FRAMERELAYMPI = 0x5c - IFT_FRDLCIENDPT = 0xc1 - IFT_FRELAY = 0x20 - IFT_FRELAYDCE = 0x2c - IFT_FRF16MFRBUNDLE = 0xa3 - IFT_FRFORWARD = 0x9e - IFT_G703AT2MB = 0x43 - IFT_G703AT64K = 0x42 - IFT_GIF = 0xf0 - IFT_GIGABITETHERNET = 0x75 - IFT_GR303IDT = 0xb2 - IFT_GR303RDT = 0xb1 - IFT_H323GATEKEEPER = 0xa4 - IFT_H323PROXY = 0xa5 - IFT_HDH1822 = 0x3 - IFT_HDLC = 0x76 - IFT_HDSL2 = 0xa8 - IFT_HIPERLAN2 = 0xb7 - IFT_HIPPI = 0x2f - IFT_HIPPIINTERFACE = 0x39 - IFT_HOSTPAD = 0x5a - IFT_HSSI = 0x2e - IFT_HY = 0xe - IFT_IBM370PARCHAN = 0x48 - IFT_IDSL = 0x9a - IFT_IEEE80211 = 0x47 - IFT_IEEE80212 = 0x37 - IFT_IEEE8023ADLAG = 0xa1 - IFT_IFGSN = 0x91 - IFT_IMT = 0xbe - IFT_INTERLEAVE = 0x7c - IFT_IP = 0x7e - IFT_IPFORWARD = 0x8e - IFT_IPOVERATM = 0x72 - IFT_IPOVERCDLC = 0x6d - IFT_IPOVERCLAW = 0x6e - IFT_IPSWITCH = 0x4e - IFT_IPXIP = 0xf9 - IFT_ISDN = 0x3f - IFT_ISDNBASIC = 0x14 - IFT_ISDNPRIMARY = 0x15 - IFT_ISDNS = 0x4b - IFT_ISDNU = 0x4c - IFT_ISO88022LLC = 0x29 - IFT_ISO88023 = 0x7 - IFT_ISO88024 = 0x8 - IFT_ISO88025 = 0x9 - IFT_ISO88025CRFPINT = 0x62 - IFT_ISO88025DTR = 0x56 - IFT_ISO88025FIBER = 0x73 - IFT_ISO88026 = 0xa - IFT_ISUP = 0xb3 - IFT_L3IPXVLAN = 0x89 - IFT_LAPB = 0x10 - IFT_LAPD = 0x4d - IFT_LAPF = 0x77 - IFT_LOCALTALK = 0x2a - IFT_LOOP = 0x18 - IFT_MEDIAMAILOVERIP = 0x8b - IFT_MFSIGLINK = 0xa7 - IFT_MIOX25 = 0x26 - IFT_MODEM = 0x30 - IFT_MPC = 0x71 - IFT_MPLS = 0xa6 - IFT_MPLSTUNNEL = 0x96 - IFT_MSDSL = 0x8f - IFT_MVL = 0xbf - IFT_MYRINET = 0x63 - IFT_NFAS = 0xaf - IFT_NSIP = 0x1b - IFT_OPTICALCHANNEL = 0xc3 - IFT_OPTICALTRANSPORT = 0xc4 - IFT_OTHER = 0x1 - IFT_P10 = 0xc - IFT_P80 = 0xd - IFT_PARA = 0x22 - IFT_PFLOG = 0xf6 - IFT_PFSYNC = 0xf7 - IFT_PLC = 0xae - IFT_POS = 0xab - IFT_PPPMULTILINKBUNDLE = 0x6c - IFT_PROPBWAP2MP = 0xb8 - IFT_PROPCNLS = 0x59 - IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 - IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 - IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 - IFT_PROPMUX = 0x36 - IFT_PROPWIRELESSP2P = 0x9d - IFT_PTPSERIAL = 0x16 - IFT_PVC = 0xf1 - IFT_QLLC = 0x44 - IFT_RADIOMAC = 0xbc - IFT_RADSL = 0x5f - IFT_REACHDSL = 0xc0 - IFT_RFC1483 = 0x9f - IFT_RS232 = 0x21 - IFT_RSRB = 0x4f - IFT_SDLC = 0x11 - IFT_SDSL = 0x60 - IFT_SHDSL = 0xa9 - IFT_SIP = 0x1f - IFT_SLIP = 0x1c - IFT_SMDSDXI = 0x2b - IFT_SMDSICIP = 0x34 - IFT_SONET = 0x27 - IFT_SONETOVERHEADCHANNEL = 0xb9 - IFT_SONETPATH = 0x32 - IFT_SONETVT = 0x33 - IFT_SRP = 0x97 - IFT_SS7SIGLINK = 0x9c - IFT_STACKTOSTACK = 0x6f - IFT_STARLAN = 0xb - IFT_STF = 0xd7 - IFT_T1 = 0x12 - IFT_TDLC = 0x74 - IFT_TERMPAD = 0x5b - IFT_TR008 = 0xb0 - IFT_TRANSPHDLC = 0x7b - IFT_TUNNEL = 0x83 - IFT_ULTRA = 0x1d - IFT_USB = 0xa0 - IFT_V11 = 0x40 - IFT_V35 = 0x2d - IFT_V36 = 0x41 - IFT_V37 = 0x78 - IFT_VDSL = 0x61 - IFT_VIRTUALIPADDRESS = 0x70 - IFT_VOICEEM = 0x64 - IFT_VOICEENCAP = 0x67 - IFT_VOICEFXO = 0x65 - IFT_VOICEFXS = 0x66 - IFT_VOICEOVERATM = 0x98 - IFT_VOICEOVERFRAMERELAY = 0x99 - IFT_VOICEOVERIP = 0x68 - IFT_X213 = 0x5d - IFT_X25 = 0x5 - IFT_X25DDN = 0x4 - IFT_X25HUNTGROUP = 0x7a - IFT_X25MLP = 0x79 - IFT_X25PLE = 0x28 - IFT_XETHER = 0x1a - IPPROTO_MAXID = 0x34 - IPV6_FAITH = 0x1d - IPV6_MIN_MEMBERSHIPS = 0x1f - IP_FAITH = 0x16 - IP_MAX_SOURCE_FILTER = 0x400 - IP_MIN_MEMBERSHIPS = 0x1f - MAP_NORESERVE = 0x40 - MAP_RENAME = 0x20 - NET_RT_MAXID = 0x6 - RTF_PRCLONING = 0x10000 - RTM_OLDADD = 0x9 - RTM_OLDDEL = 0xa - RT_CACHING_CONTEXT = 0x1 - RT_NORTREF = 0x2 - SIOCADDRT = 0x8040720a - SIOCALIFADDR = 0x8118691b - SIOCDELRT = 0x8040720b - SIOCDLIFADDR = 0x8118691d - SIOCGLIFADDR = 0xc118691c - SIOCGLIFPHYADDR = 0xc118694b - SIOCSLIFPHYADDR = 0x8118694a -) diff --git a/vendor/golang.org/x/sys/unix/errors_freebsd_arm.go b/vendor/golang.org/x/sys/unix/errors_freebsd_arm.go deleted file mode 100644 index 856dca32..00000000 --- a/vendor/golang.org/x/sys/unix/errors_freebsd_arm.go +++ /dev/null @@ -1,226 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package unix - -const ( - IFT_1822 = 0x2 - IFT_A12MPPSWITCH = 0x82 - IFT_AAL2 = 0xbb - IFT_AAL5 = 0x31 - IFT_ADSL = 0x5e - IFT_AFLANE8023 = 0x3b - IFT_AFLANE8025 = 0x3c - IFT_ARAP = 0x58 - IFT_ARCNET = 0x23 - IFT_ARCNETPLUS = 0x24 - IFT_ASYNC = 0x54 - IFT_ATM = 0x25 - IFT_ATMDXI = 0x69 - IFT_ATMFUNI = 0x6a - IFT_ATMIMA = 0x6b - IFT_ATMLOGICAL = 0x50 - IFT_ATMRADIO = 0xbd - IFT_ATMSUBINTERFACE = 0x86 - IFT_ATMVCIENDPT = 0xc2 - IFT_ATMVIRTUAL = 0x95 - IFT_BGPPOLICYACCOUNTING = 0xa2 - IFT_BSC = 0x53 - IFT_CCTEMUL = 0x3d - IFT_CEPT = 0x13 - IFT_CES = 0x85 - IFT_CHANNEL = 0x46 - IFT_CNR = 0x55 - IFT_COFFEE = 0x84 - IFT_COMPOSITELINK = 0x9b - IFT_DCN = 0x8d - IFT_DIGITALPOWERLINE = 0x8a - IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba - IFT_DLSW = 0x4a - IFT_DOCSCABLEDOWNSTREAM = 0x80 - IFT_DOCSCABLEMACLAYER = 0x7f - IFT_DOCSCABLEUPSTREAM = 0x81 - IFT_DS0 = 0x51 - IFT_DS0BUNDLE = 0x52 - IFT_DS1FDL = 0xaa - IFT_DS3 = 0x1e - IFT_DTM = 0x8c - IFT_DVBASILN = 0xac - IFT_DVBASIOUT = 0xad - IFT_DVBRCCDOWNSTREAM = 0x93 - IFT_DVBRCCMACLAYER = 0x92 - IFT_DVBRCCUPSTREAM = 0x94 - IFT_ENC = 0xf4 - IFT_EON = 0x19 - IFT_EPLRS = 0x57 - IFT_ESCON = 0x49 - IFT_ETHER = 0x6 - IFT_FAST = 0x7d - IFT_FASTETHER = 0x3e - IFT_FASTETHERFX = 0x45 - IFT_FDDI = 0xf - IFT_FIBRECHANNEL = 0x38 - IFT_FRAMERELAYINTERCONNECT = 0x3a - IFT_FRAMERELAYMPI = 0x5c - IFT_FRDLCIENDPT = 0xc1 - IFT_FRELAY = 0x20 - IFT_FRELAYDCE = 0x2c - IFT_FRF16MFRBUNDLE = 0xa3 - IFT_FRFORWARD = 0x9e - IFT_G703AT2MB = 0x43 - IFT_G703AT64K = 0x42 - IFT_GIF = 0xf0 - IFT_GIGABITETHERNET = 0x75 - IFT_GR303IDT = 0xb2 - IFT_GR303RDT = 0xb1 - IFT_H323GATEKEEPER = 0xa4 - IFT_H323PROXY = 0xa5 - IFT_HDH1822 = 0x3 - IFT_HDLC = 0x76 - IFT_HDSL2 = 0xa8 - IFT_HIPERLAN2 = 0xb7 - IFT_HIPPI = 0x2f - IFT_HIPPIINTERFACE = 0x39 - IFT_HOSTPAD = 0x5a - IFT_HSSI = 0x2e - IFT_HY = 0xe - IFT_IBM370PARCHAN = 0x48 - IFT_IDSL = 0x9a - IFT_IEEE80211 = 0x47 - IFT_IEEE80212 = 0x37 - IFT_IEEE8023ADLAG = 0xa1 - IFT_IFGSN = 0x91 - IFT_IMT = 0xbe - IFT_INTERLEAVE = 0x7c - IFT_IP = 0x7e - IFT_IPFORWARD = 0x8e - IFT_IPOVERATM = 0x72 - IFT_IPOVERCDLC = 0x6d - IFT_IPOVERCLAW = 0x6e - IFT_IPSWITCH = 0x4e - IFT_ISDN = 0x3f - IFT_ISDNBASIC = 0x14 - IFT_ISDNPRIMARY = 0x15 - IFT_ISDNS = 0x4b - IFT_ISDNU = 0x4c - IFT_ISO88022LLC = 0x29 - IFT_ISO88023 = 0x7 - IFT_ISO88024 = 0x8 - IFT_ISO88025 = 0x9 - IFT_ISO88025CRFPINT = 0x62 - IFT_ISO88025DTR = 0x56 - IFT_ISO88025FIBER = 0x73 - IFT_ISO88026 = 0xa - IFT_ISUP = 0xb3 - IFT_L3IPXVLAN = 0x89 - IFT_LAPB = 0x10 - IFT_LAPD = 0x4d - IFT_LAPF = 0x77 - IFT_LOCALTALK = 0x2a - IFT_LOOP = 0x18 - IFT_MEDIAMAILOVERIP = 0x8b - IFT_MFSIGLINK = 0xa7 - IFT_MIOX25 = 0x26 - IFT_MODEM = 0x30 - IFT_MPC = 0x71 - IFT_MPLS = 0xa6 - IFT_MPLSTUNNEL = 0x96 - IFT_MSDSL = 0x8f - IFT_MVL = 0xbf - IFT_MYRINET = 0x63 - IFT_NFAS = 0xaf - IFT_NSIP = 0x1b - IFT_OPTICALCHANNEL = 0xc3 - IFT_OPTICALTRANSPORT = 0xc4 - IFT_OTHER = 0x1 - IFT_P10 = 0xc - IFT_P80 = 0xd - IFT_PARA = 0x22 - IFT_PFLOG = 0xf6 - IFT_PFSYNC = 0xf7 - IFT_PLC = 0xae - IFT_POS = 0xab - IFT_PPPMULTILINKBUNDLE = 0x6c - IFT_PROPBWAP2MP = 0xb8 - IFT_PROPCNLS = 0x59 - IFT_PROPDOCSWIRELESSDOWNSTREAM = 0xb5 - IFT_PROPDOCSWIRELESSMACLAYER = 0xb4 - IFT_PROPDOCSWIRELESSUPSTREAM = 0xb6 - IFT_PROPMUX = 0x36 - IFT_PROPWIRELESSP2P = 0x9d - IFT_PTPSERIAL = 0x16 - IFT_PVC = 0xf1 - IFT_QLLC = 0x44 - IFT_RADIOMAC = 0xbc - IFT_RADSL = 0x5f - IFT_REACHDSL = 0xc0 - IFT_RFC1483 = 0x9f - IFT_RS232 = 0x21 - IFT_RSRB = 0x4f - IFT_SDLC = 0x11 - IFT_SDSL = 0x60 - IFT_SHDSL = 0xa9 - IFT_SIP = 0x1f - IFT_SLIP = 0x1c - IFT_SMDSDXI = 0x2b - IFT_SMDSICIP = 0x34 - IFT_SONET = 0x27 - IFT_SONETOVERHEADCHANNEL = 0xb9 - IFT_SONETPATH = 0x32 - IFT_SONETVT = 0x33 - IFT_SRP = 0x97 - IFT_SS7SIGLINK = 0x9c - IFT_STACKTOSTACK = 0x6f - IFT_STARLAN = 0xb - IFT_STF = 0xd7 - IFT_T1 = 0x12 - IFT_TDLC = 0x74 - IFT_TERMPAD = 0x5b - IFT_TR008 = 0xb0 - IFT_TRANSPHDLC = 0x7b - IFT_TUNNEL = 0x83 - IFT_ULTRA = 0x1d - IFT_USB = 0xa0 - IFT_V11 = 0x40 - IFT_V35 = 0x2d - IFT_V36 = 0x41 - IFT_V37 = 0x78 - IFT_VDSL = 0x61 - IFT_VIRTUALIPADDRESS = 0x70 - IFT_VOICEEM = 0x64 - IFT_VOICEENCAP = 0x67 - IFT_VOICEFXO = 0x65 - IFT_VOICEFXS = 0x66 - IFT_VOICEOVERATM = 0x98 - IFT_VOICEOVERFRAMERELAY = 0x99 - IFT_VOICEOVERIP = 0x68 - IFT_X213 = 0x5d - IFT_X25 = 0x5 - IFT_X25DDN = 0x4 - IFT_X25HUNTGROUP = 0x7a - IFT_X25MLP = 0x79 - IFT_X25PLE = 0x28 - IFT_XETHER = 0x1a - - // missing constants on FreeBSD-11.1-RELEASE, copied from old values in ztypes_freebsd_arm.go - IFF_SMART = 0x20 - IFT_FAITH = 0xf2 - IFT_IPXIP = 0xf9 - IPPROTO_MAXID = 0x34 - IPV6_FAITH = 0x1d - IP_FAITH = 0x16 - MAP_NORESERVE = 0x40 - MAP_RENAME = 0x20 - NET_RT_MAXID = 0x6 - RTF_PRCLONING = 0x10000 - RTM_OLDADD = 0x9 - RTM_OLDDEL = 0xa - SIOCADDRT = 0x8030720a - SIOCALIFADDR = 0x8118691b - SIOCDELRT = 0x8030720b - SIOCDLIFADDR = 0x8118691d - SIOCGLIFADDR = 0xc118691c - SIOCGLIFPHYADDR = 0xc118694b - SIOCSLIFPHYADDR = 0x8118694a -) diff --git a/vendor/golang.org/x/sys/unix/errors_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/errors_freebsd_arm64.go deleted file mode 100644 index 946dcf3f..00000000 --- a/vendor/golang.org/x/sys/unix/errors_freebsd_arm64.go +++ /dev/null @@ -1,17 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Constants that were deprecated or moved to enums in the FreeBSD headers. Keep -// them here for backwards compatibility. - -package unix - -const ( - DLT_HHDLC = 0x79 - IPV6_MIN_MEMBERSHIPS = 0x1f - IP_MAX_SOURCE_FILTER = 0x400 - IP_MIN_MEMBERSHIPS = 0x1f - RT_CACHING_CONTEXT = 0x1 - RT_NORTREF = 0x2 -) diff --git a/vendor/golang.org/x/sys/unix/ifreq_linux.go b/vendor/golang.org/x/sys/unix/ifreq_linux.go index 934af313..15721a51 100644 --- a/vendor/golang.org/x/sys/unix/ifreq_linux.go +++ b/vendor/golang.org/x/sys/unix/ifreq_linux.go @@ -8,7 +8,6 @@ package unix import ( - "bytes" "unsafe" ) @@ -45,13 +44,7 @@ func NewIfreq(name string) (*Ifreq, error) { // Name returns the interface name associated with the Ifreq. func (ifr *Ifreq) Name() string { - // BytePtrToString requires a NULL terminator or the program may crash. If - // one is not present, just return the empty string. - if !bytes.Contains(ifr.raw.Ifrn[:], []byte{0x00}) { - return "" - } - - return BytePtrToString(&ifr.raw.Ifrn[0]) + return ByteSliceToString(ifr.raw.Ifrn[:]) } // According to netdevice(7), only AF_INET addresses are returned for numerous diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 1dadead2..884430b8 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -194,3 +194,26 @@ func ioctlIfreqData(fd int, req uint, value *ifreqData) error { // identical so pass *IfreqData directly. return ioctlPtr(fd, req, unsafe.Pointer(value)) } + +// IoctlKCMClone attaches a new file descriptor to a multiplexor by cloning an +// existing KCM socket, returning a structure containing the file descriptor of +// the new socket. +func IoctlKCMClone(fd int) (*KCMClone, error) { + var info KCMClone + if err := ioctlPtr(fd, SIOCKCMCLONE, unsafe.Pointer(&info)); err != nil { + return nil, err + } + + return &info, nil +} + +// IoctlKCMAttach attaches a TCP socket and associated BPF program file +// descriptor to a multiplexor. +func IoctlKCMAttach(fd int, info KCMAttach) error { + return ioctlPtr(fd, SIOCKCMATTACH, unsafe.Pointer(&info)) +} + +// IoctlKCMUnattach unattaches a TCP socket file descriptor from a multiplexor. +func IoctlKCMUnattach(fd int, info KCMUnattach) error { + return ioctlPtr(fd, SIOCKCMUNATTACH, unsafe.Pointer(&info)) +} diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index ee736234..dcef4de6 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -89,25 +89,30 @@ dragonfly_amd64) freebsd_386) mkerrors="$mkerrors -m32" mksyscall="go run mksyscall.go -l32" - mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'" + mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'" mktypes="GOARCH=$GOARCH go tool cgo -godefs" ;; freebsd_amd64) mkerrors="$mkerrors -m64" - mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'" + mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'" mktypes="GOARCH=$GOARCH go tool cgo -godefs" ;; freebsd_arm) mkerrors="$mkerrors" mksyscall="go run mksyscall.go -l32 -arm" - mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'" + mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'" # Let the type of C char be signed for making the bare syscall # API consistent across platforms. mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" ;; freebsd_arm64) mkerrors="$mkerrors -m64" - mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'" + mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'" + mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" + ;; +freebsd_riscv64) + mkerrors="$mkerrors -m64" + mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'" mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char" ;; netbsd_386) diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index a47b035f..2ab44aa6 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -128,6 +128,7 @@ includes_FreeBSD=' #include #include #include +#include #include #include #include @@ -202,9 +203,11 @@ struct ltchars { #include #include #include +#include #include #include #include +#include #include #include #include @@ -214,6 +217,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -231,6 +235,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -292,6 +297,10 @@ struct ltchars { #define SOL_NETLINK 270 #endif +#ifndef SOL_SMC +#define SOL_SMC 286 +#endif + #ifdef SOL_BLUETOOTH // SPARC includes this in /usr/include/sparc64-linux-gnu/bits/socket.h // but it is already in bluetooth_linux.go @@ -503,6 +512,7 @@ ccflags="$@" $2 ~ /^O?XTABS$/ || $2 ~ /^TC[IO](ON|OFF)$/ || $2 ~ /^IN_/ || + $2 ~ /^KCM/ || $2 ~ /^LANDLOCK_/ || $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || @@ -525,7 +535,7 @@ ccflags="$@" $2 ~ /^(MS|MNT|MOUNT|UMOUNT)_/ || $2 ~ /^NS_GET_/ || $2 ~ /^TUN(SET|GET|ATTACH|DETACH)/ || - $2 ~ /^(O|F|[ES]?FD|NAME|S|PTRACE|PT|TFD)_/ || + $2 ~ /^(O|F|[ES]?FD|NAME|S|PTRACE|PT|PIOD|TFD)_/ || $2 ~ /^KEXEC_/ || $2 ~ /^LINUX_REBOOT_CMD_/ || $2 ~ /^LINUX_REBOOT_MAGIC[12]$/ || @@ -549,6 +559,7 @@ ccflags="$@" $2 ~ /^CLONE_[A-Z_]+/ || $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ && $2 ~ /^(BPF|DLT)_/ || + $2 ~ /^AUDIT_/ || $2 ~ /^(CLOCK|TIMER)_/ || $2 ~ /^CAN_/ || $2 ~ /^CAP_/ || @@ -571,7 +582,6 @@ ccflags="$@" $2 ~ /^SEEK_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || - $2 !~ /^AUDIT_RECORD_MAGIC/ && $2 !~ /IOC_MAGIC/ && $2 ~ /^[A-Z][A-Z0-9_]+_MAGIC2?$/ || $2 ~ /^(VM|VMADDR)_/ || @@ -597,8 +607,10 @@ ccflags="$@" $2 ~ /^DEVLINK_/ || $2 ~ /^ETHTOOL_/ || $2 ~ /^LWTUNNEL_IP/ || + $2 ~ /^ITIMER_/ || $2 !~ "WMESGLEN" && $2 ~ /^W[A-Z0-9]+$/ || + $2 ~ /^P_/ || $2 ~/^PPPIOC/ || $2 ~ /^FAN_|FANOTIFY_/ || $2 == "HID_MAX_DESCRIPTOR_SIZE" || @@ -608,6 +620,7 @@ ccflags="$@" $2 ~ /^OTP/ || $2 ~ /^MEM/ || $2 ~ /^WG/ || + $2 ~ /^FIB_RULE_/ || $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index 4f55c8d9..ac579c60 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -37,6 +37,7 @@ func Creat(path string, mode uint32) (fd int, err error) { } //sys utimes(path string, times *[2]Timeval) (err error) + func Utimes(path string, tv []Timeval) error { if len(tv) != 2 { return EINVAL @@ -45,6 +46,7 @@ func Utimes(path string, tv []Timeval) error { } //sys utimensat(dirfd int, path string, times *[2]Timespec, flag int) (err error) + func UtimesNano(path string, ts []Timespec) error { if len(ts) != 2 { return EINVAL @@ -215,18 +217,12 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) { return } -func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { // Recvmsg not implemented on AIX - sa := new(SockaddrUnix) - return -1, -1, -1, sa, ENOSYS -} - -func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { - _, err = SendmsgN(fd, p, oob, to, flags) - return + return -1, -1, -1, ENOSYS } -func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { // SendmsgN not implemented on AIX return -1, ENOSYS } @@ -306,11 +302,13 @@ func direntNamlen(buf []byte) (uint64, bool) { } //sys getdirent(fd int, buf []byte) (n int, err error) + func Getdents(fd int, buf []byte) (n int, err error) { return getdirent(fd, buf) } //sys wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, err error) + func Wait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error) { var status _C_int var r Pid_t @@ -378,6 +376,7 @@ func (w WaitStatus) TrapCause() int { return -1 } //sys fcntl(fd int, cmd int, arg int) (val int, err error) //sys fsyncRange(fd int, how int, start int64, length int64) (err error) = fsync_range + func Fsync(fd int) error { return fsyncRange(fd, O_SYNC, 0, 0) } @@ -458,8 +457,8 @@ func Fsync(fd int) error { //sys Listen(s int, n int) (err error) //sys lstat(path string, stat *Stat_t) (err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = pread64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = pwrite64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = pread64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = pwrite64 //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) //sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) //sysnb Setregid(rgid int, egid int) (err error) @@ -542,6 +541,7 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { //sys Getsystemcfg(label int) (n uint64) //sys umount(target string) (err error) + func Unmount(target string, flags int) (err error) { if flags != 0 { // AIX doesn't have any flags for umount. diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 0ce45232..c437fc5d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -325,80 +325,62 @@ func GetsockoptString(fd, level, opt int) (string, error) { //sys sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) //sys recvmsg(s int, msg *Msghdr, flags int) (n int, err error) -func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { var msg Msghdr - var rsa RawSockaddrAny - msg.Name = (*byte)(unsafe.Pointer(&rsa)) + msg.Name = (*byte)(unsafe.Pointer(rsa)) msg.Namelen = uint32(SizeofSockaddrAny) - var iov Iovec - if len(p) > 0 { - iov.Base = (*byte)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } var dummy byte if len(oob) > 0 { // receive at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + if emptyIovecs(iov) { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Control = (*byte)(unsafe.Pointer(&oob[0])) msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = recvmsg(fd, &msg, flags); err != nil { return } oobn = int(msg.Controllen) recvflags = int(msg.Flags) - // source address is only specified if the socket is unconnected - if rsa.Addr.Family != AF_UNSPEC { - from, err = anyToSockaddr(fd, &rsa) - } return } //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) -func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { - _, err = SendmsgN(fd, p, oob, to, flags) - return -} - -func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { - var ptr unsafe.Pointer - var salen _Socklen - if to != nil { - ptr, salen, err = to.sockaddr() - if err != nil { - return 0, err - } - } +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(ptr)) msg.Namelen = uint32(salen) - var iov Iovec - if len(p) > 0 { - iov.Base = (*byte)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } var dummy byte + var empty bool if len(oob) > 0 { // send at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + empty := emptyIovecs(iov) + if empty { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Control = (*byte)(unsafe.Pointer(&oob[0])) msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = sendmsg(fd, &msg, flags); err != nil { return 0, err } - if len(oob) > 0 && len(p) == 0 { + if len(oob) > 0 && empty { n = 0 } return n, nil @@ -571,12 +553,7 @@ func UtimesNano(path string, ts []Timespec) error { if len(ts) != 2 { return EINVAL } - // Darwin setattrlist can set nanosecond timestamps - err := setattrlistTimes(path, ts, 0) - if err != ENOSYS { - return err - } - err = utimensat(AT_FDCWD, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), 0) + err := utimensat(AT_FDCWD, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), 0) if err != ENOSYS { return err } @@ -596,10 +573,6 @@ func UtimesNanoAt(dirfd int, path string, ts []Timespec, flags int) error { if len(ts) != 2 { return EINVAL } - err := setattrlistTimes(path, ts, flags) - if err != ENOSYS { - return err - } return utimensat(dirfd, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), flags) } diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 0eaab913..4f87f16e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -141,16 +141,6 @@ func direntNamlen(buf []byte) (uint64, bool) { func PtraceAttach(pid int) (err error) { return ptrace(PT_ATTACH, pid, 0, 0) } func PtraceDetach(pid int) (err error) { return ptrace(PT_DETACH, pid, 0, 0) } -type attrList struct { - bitmapCount uint16 - _ uint16 - CommonAttr uint32 - VolAttr uint32 - DirAttr uint32 - FileAttr uint32 - Forkattr uint32 -} - //sysnb pipe(p *[2]int32) (err error) func Pipe(p []int) (err error) { @@ -282,36 +272,7 @@ func Flistxattr(fd int, dest []byte) (sz int, err error) { return flistxattr(fd, xattrPointer(dest), len(dest), 0) } -func setattrlistTimes(path string, times []Timespec, flags int) error { - _p0, err := BytePtrFromString(path) - if err != nil { - return err - } - - var attrList attrList - attrList.bitmapCount = ATTR_BIT_MAP_COUNT - attrList.CommonAttr = ATTR_CMN_MODTIME | ATTR_CMN_ACCTIME - - // order is mtime, atime: the opposite of Chtimes - attributes := [2]Timespec{times[1], times[0]} - options := 0 - if flags&AT_SYMLINK_NOFOLLOW != 0 { - options |= FSOPT_NOFOLLOW - } - return setattrlist( - _p0, - unsafe.Pointer(&attrList), - unsafe.Pointer(&attributes), - unsafe.Sizeof(attributes), - options) -} - -//sys setattrlist(path *byte, list unsafe.Pointer, buf unsafe.Pointer, size uintptr, options int) (err error) - -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) error { - // Darwin doesn't support SYS_UTIMENSAT - return ENOSYS -} +//sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) /* * Wrapped @@ -432,6 +393,13 @@ func GetsockoptXucred(fd, level, opt int) (*Xucred, error) { return x, err } +func GetsockoptTCPConnectionInfo(fd, level, opt int) (*TCPConnectionInfo, error) { + var value TCPConnectionInfo + vallen := _Socklen(SizeofTCPConnectionInfo) + err := getsockopt(fd, level, opt, unsafe.Pointer(&value), &vallen) + return &value, err +} + func SysctlKinfoProc(name string, args ...int) (*KinfoProc, error) { mib, err := sysctlmib(name, args...) if err != nil { @@ -543,11 +511,12 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Mkdirat(dirfd int, path string, mode uint32) (err error) //sys Mkfifo(path string, mode uint32) (err error) //sys Mknod(path string, mode uint32, dev int) (err error) +//sys Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error) //sys Open(path string, mode int, perm uint32) (fd int, err error) //sys Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) //sys Pathconf(path string, name int) (val int, err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Readlink(path string, buf []byte) (n int, err error) //sys Readlinkat(dirfd int, path string, buf []byte) (n int, err error) @@ -611,7 +580,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { // Nfssvc // Getfh // Quotactl -// Mount // Csops // Waitid // Add_profil diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index 2e37c316..61c0d0de 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -125,12 +125,14 @@ func Pipe2(p []int, flags int) (err error) { } //sys extpread(fd int, p []byte, flags int, offset int64) (n int, err error) -func Pread(fd int, p []byte, offset int64) (n int, err error) { + +func pread(fd int, p []byte, offset int64) (n int, err error) { return extpread(fd, p, 0, offset) } //sys extpwrite(fd int, p []byte, flags int, offset int64) (n int, err error) -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { return extpwrite(fd, p, 0, offset) } @@ -169,11 +171,6 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } -func setattrlistTimes(path string, times []Timespec, flags int) error { - // used on Darwin for UtimesNano - return ENOSYS -} - //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index 2f650ae6..de7c23e0 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -17,25 +17,12 @@ import ( "unsafe" ) -const ( - SYS_FSTAT_FREEBSD12 = 551 // { int fstat(int fd, _Out_ struct stat *sb); } - SYS_FSTATAT_FREEBSD12 = 552 // { int fstatat(int fd, _In_z_ char *path, \ - SYS_GETDIRENTRIES_FREEBSD12 = 554 // { ssize_t getdirentries(int fd, \ - SYS_STATFS_FREEBSD12 = 555 // { int statfs(_In_z_ char *path, \ - SYS_FSTATFS_FREEBSD12 = 556 // { int fstatfs(int fd, \ - SYS_GETFSSTAT_FREEBSD12 = 557 // { int getfsstat( \ - SYS_MKNODAT_FREEBSD12 = 559 // { int mknodat(int fd, _In_z_ char *path, \ -) - // See https://www.freebsd.org/doc/en_US.ISO8859-1/books/porters-handbook/versions.html. var ( osreldateOnce sync.Once osreldate uint32 ) -// INO64_FIRST from /usr/src/lib/libc/sys/compat-ino64.h -const _ino64First = 1200031 - func supportsABI(ver uint32) bool { osreldateOnce.Do(func() { osreldate, _ = SysctlUint32("kern.osreldate") }) return osreldate >= ver @@ -159,46 +146,21 @@ func Accept4(fd, flags int) (nfd int, sa Sockaddr, err error) { func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { var ( - _p0 unsafe.Pointer - bufsize uintptr - oldBuf []statfs_freebsd11_t - needsConvert bool + _p0 unsafe.Pointer + bufsize uintptr ) - if len(buf) > 0 { - if supportsABI(_ino64First) { - _p0 = unsafe.Pointer(&buf[0]) - bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf)) - } else { - n := len(buf) - oldBuf = make([]statfs_freebsd11_t, n) - _p0 = unsafe.Pointer(&oldBuf[0]) - bufsize = unsafe.Sizeof(statfs_freebsd11_t{}) * uintptr(n) - needsConvert = true - } - } - var sysno uintptr = SYS_GETFSSTAT - if supportsABI(_ino64First) { - sysno = SYS_GETFSSTAT_FREEBSD12 + _p0 = unsafe.Pointer(&buf[0]) + bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf)) } - r0, _, e1 := Syscall(sysno, uintptr(_p0), bufsize, uintptr(flags)) + r0, _, e1 := Syscall(SYS_GETFSSTAT, uintptr(_p0), bufsize, uintptr(flags)) n = int(r0) if e1 != 0 { err = e1 } - if e1 == 0 && needsConvert { - for i := range oldBuf { - buf[i].convertFrom(&oldBuf[i]) - } - } return } -func setattrlistTimes(path string, times []Timespec, flags int) error { - // used on Darwin for UtimesNano - return ENOSYS -} - //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL @@ -250,87 +212,11 @@ func Uname(uname *Utsname) error { } func Stat(path string, st *Stat_t) (err error) { - var oldStat stat_freebsd11_t - if supportsABI(_ino64First) { - return fstatat_freebsd12(AT_FDCWD, path, st, 0) - } - err = stat(path, &oldStat) - if err != nil { - return err - } - - st.convertFrom(&oldStat) - return nil + return Fstatat(AT_FDCWD, path, st, 0) } func Lstat(path string, st *Stat_t) (err error) { - var oldStat stat_freebsd11_t - if supportsABI(_ino64First) { - return fstatat_freebsd12(AT_FDCWD, path, st, AT_SYMLINK_NOFOLLOW) - } - err = lstat(path, &oldStat) - if err != nil { - return err - } - - st.convertFrom(&oldStat) - return nil -} - -func Fstat(fd int, st *Stat_t) (err error) { - var oldStat stat_freebsd11_t - if supportsABI(_ino64First) { - return fstat_freebsd12(fd, st) - } - err = fstat(fd, &oldStat) - if err != nil { - return err - } - - st.convertFrom(&oldStat) - return nil -} - -func Fstatat(fd int, path string, st *Stat_t, flags int) (err error) { - var oldStat stat_freebsd11_t - if supportsABI(_ino64First) { - return fstatat_freebsd12(fd, path, st, flags) - } - err = fstatat(fd, path, &oldStat, flags) - if err != nil { - return err - } - - st.convertFrom(&oldStat) - return nil -} - -func Statfs(path string, st *Statfs_t) (err error) { - var oldStatfs statfs_freebsd11_t - if supportsABI(_ino64First) { - return statfs_freebsd12(path, st) - } - err = statfs(path, &oldStatfs) - if err != nil { - return err - } - - st.convertFrom(&oldStatfs) - return nil -} - -func Fstatfs(fd int, st *Statfs_t) (err error) { - var oldStatfs statfs_freebsd11_t - if supportsABI(_ino64First) { - return fstatfs_freebsd12(fd, st) - } - err = fstatfs(fd, &oldStatfs) - if err != nil { - return err - } - - st.convertFrom(&oldStatfs) - return nil + return Fstatat(AT_FDCWD, path, st, AT_SYMLINK_NOFOLLOW) } func Getdents(fd int, buf []byte) (n int, err error) { @@ -338,162 +224,25 @@ func Getdents(fd int, buf []byte) (n int, err error) { } func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { - if supportsABI(_ino64First) { - if basep == nil || unsafe.Sizeof(*basep) == 8 { - return getdirentries_freebsd12(fd, buf, (*uint64)(unsafe.Pointer(basep))) - } - // The freebsd12 syscall needs a 64-bit base. On 32-bit machines - // we can't just use the basep passed in. See #32498. - var base uint64 = uint64(*basep) - n, err = getdirentries_freebsd12(fd, buf, &base) - *basep = uintptr(base) - if base>>32 != 0 { - // We can't stuff the base back into a uintptr, so any - // future calls would be suspect. Generate an error. - // EIO is allowed by getdirentries. - err = EIO - } - return - } - - // The old syscall entries are smaller than the new. Use 1/4 of the original - // buffer size rounded up to DIRBLKSIZ (see /usr/src/lib/libc/sys/getdirentries.c). - oldBufLen := roundup(len(buf)/4, _dirblksiz) - oldBuf := make([]byte, oldBufLen) - n, err = getdirentries(fd, oldBuf, basep) - if err == nil && n > 0 { - n = convertFromDirents11(buf, oldBuf[:n]) + if basep == nil || unsafe.Sizeof(*basep) == 8 { + return getdirentries(fd, buf, (*uint64)(unsafe.Pointer(basep))) + } + // The syscall needs a 64-bit base. On 32-bit machines + // we can't just use the basep passed in. See #32498. + var base uint64 = uint64(*basep) + n, err = getdirentries(fd, buf, &base) + *basep = uintptr(base) + if base>>32 != 0 { + // We can't stuff the base back into a uintptr, so any + // future calls would be suspect. Generate an error. + // EIO is allowed by getdirentries. + err = EIO } return } func Mknod(path string, mode uint32, dev uint64) (err error) { - var oldDev int - if supportsABI(_ino64First) { - return mknodat_freebsd12(AT_FDCWD, path, mode, dev) - } - oldDev = int(dev) - return mknod(path, mode, oldDev) -} - -func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) { - var oldDev int - if supportsABI(_ino64First) { - return mknodat_freebsd12(fd, path, mode, dev) - } - oldDev = int(dev) - return mknodat(fd, path, mode, oldDev) -} - -// round x to the nearest multiple of y, larger or equal to x. -// -// from /usr/include/sys/param.h Macros for counting and rounding. -// #define roundup(x, y) ((((x)+((y)-1))/(y))*(y)) -func roundup(x, y int) int { - return ((x + y - 1) / y) * y -} - -func (s *Stat_t) convertFrom(old *stat_freebsd11_t) { - *s = Stat_t{ - Dev: uint64(old.Dev), - Ino: uint64(old.Ino), - Nlink: uint64(old.Nlink), - Mode: old.Mode, - Uid: old.Uid, - Gid: old.Gid, - Rdev: uint64(old.Rdev), - Atim: old.Atim, - Mtim: old.Mtim, - Ctim: old.Ctim, - Btim: old.Btim, - Size: old.Size, - Blocks: old.Blocks, - Blksize: old.Blksize, - Flags: old.Flags, - Gen: uint64(old.Gen), - } -} - -func (s *Statfs_t) convertFrom(old *statfs_freebsd11_t) { - *s = Statfs_t{ - Version: _statfsVersion, - Type: old.Type, - Flags: old.Flags, - Bsize: old.Bsize, - Iosize: old.Iosize, - Blocks: old.Blocks, - Bfree: old.Bfree, - Bavail: old.Bavail, - Files: old.Files, - Ffree: old.Ffree, - Syncwrites: old.Syncwrites, - Asyncwrites: old.Asyncwrites, - Syncreads: old.Syncreads, - Asyncreads: old.Asyncreads, - // Spare - Namemax: old.Namemax, - Owner: old.Owner, - Fsid: old.Fsid, - // Charspare - // Fstypename - // Mntfromname - // Mntonname - } - - sl := old.Fstypename[:] - n := clen(*(*[]byte)(unsafe.Pointer(&sl))) - copy(s.Fstypename[:], old.Fstypename[:n]) - - sl = old.Mntfromname[:] - n = clen(*(*[]byte)(unsafe.Pointer(&sl))) - copy(s.Mntfromname[:], old.Mntfromname[:n]) - - sl = old.Mntonname[:] - n = clen(*(*[]byte)(unsafe.Pointer(&sl))) - copy(s.Mntonname[:], old.Mntonname[:n]) -} - -func convertFromDirents11(buf []byte, old []byte) int { - const ( - fixedSize = int(unsafe.Offsetof(Dirent{}.Name)) - oldFixedSize = int(unsafe.Offsetof(dirent_freebsd11{}.Name)) - ) - - dstPos := 0 - srcPos := 0 - for dstPos+fixedSize < len(buf) && srcPos+oldFixedSize < len(old) { - var dstDirent Dirent - var srcDirent dirent_freebsd11 - - // If multiple direntries are written, sometimes when we reach the final one, - // we may have cap of old less than size of dirent_freebsd11. - copy((*[unsafe.Sizeof(srcDirent)]byte)(unsafe.Pointer(&srcDirent))[:], old[srcPos:]) - - reclen := roundup(fixedSize+int(srcDirent.Namlen)+1, 8) - if dstPos+reclen > len(buf) { - break - } - - dstDirent.Fileno = uint64(srcDirent.Fileno) - dstDirent.Off = 0 - dstDirent.Reclen = uint16(reclen) - dstDirent.Type = srcDirent.Type - dstDirent.Pad0 = 0 - dstDirent.Namlen = uint16(srcDirent.Namlen) - dstDirent.Pad1 = 0 - - copy(dstDirent.Name[:], srcDirent.Name[:srcDirent.Namlen]) - copy(buf[dstPos:], (*[unsafe.Sizeof(dstDirent)]byte)(unsafe.Pointer(&dstDirent))[:]) - padding := buf[dstPos+fixedSize+int(dstDirent.Namlen) : dstPos+reclen] - for i := range padding { - padding[i] = 0 - } - - dstPos += int(dstDirent.Reclen) - srcPos += int(srcDirent.Reclen) - } - - return dstPos + return Mknodat(AT_FDCWD, path, mode, dev) } func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { @@ -506,31 +255,31 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys ptrace(request int, pid int, addr uintptr, data int) (err error) func PtraceAttach(pid int) (err error) { - return ptrace(PTRACE_ATTACH, pid, 0, 0) + return ptrace(PT_ATTACH, pid, 0, 0) } func PtraceCont(pid int, signal int) (err error) { - return ptrace(PTRACE_CONT, pid, 1, signal) + return ptrace(PT_CONTINUE, pid, 1, signal) } func PtraceDetach(pid int) (err error) { - return ptrace(PTRACE_DETACH, pid, 1, 0) + return ptrace(PT_DETACH, pid, 1, 0) } func PtraceGetFpRegs(pid int, fpregsout *FpReg) (err error) { - return ptrace(PTRACE_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0) + return ptrace(PT_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0) } func PtraceGetRegs(pid int, regsout *Reg) (err error) { - return ptrace(PTRACE_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0) + return ptrace(PT_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0) } func PtraceLwpEvents(pid int, enable int) (err error) { - return ptrace(PTRACE_LWPEVENTS, pid, 0, enable) + return ptrace(PT_LWP_EVENTS, pid, 0, enable) } func PtraceLwpInfo(pid int, info uintptr) (err error) { - return ptrace(PTRACE_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{}))) + return ptrace(PT_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{}))) } func PtracePeekData(pid int, addr uintptr, out []byte) (count int, err error) { @@ -550,11 +299,11 @@ func PtracePokeText(pid int, addr uintptr, data []byte) (count int, err error) { } func PtraceSetRegs(pid int, regs *Reg) (err error) { - return ptrace(PTRACE_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0) + return ptrace(PT_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0) } func PtraceSingleStep(pid int) (err error) { - return ptrace(PTRACE_SINGLESTEP, pid, 1, 0) + return ptrace(PT_STEP, pid, 1, 0) } /* @@ -596,16 +345,12 @@ func PtraceSingleStep(pid int) (err error) { //sys Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) //sys Flock(fd int, how int) (err error) //sys Fpathconf(fd int, name int) (val int, err error) -//sys fstat(fd int, stat *stat_freebsd11_t) (err error) -//sys fstat_freebsd12(fd int, stat *Stat_t) (err error) -//sys fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) -//sys fstatat_freebsd12(fd int, path string, stat *Stat_t, flags int) (err error) -//sys fstatfs(fd int, stat *statfs_freebsd11_t) (err error) -//sys fstatfs_freebsd12(fd int, stat *Statfs_t) (err error) +//sys Fstat(fd int, stat *Stat_t) (err error) +//sys Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) +//sys Fstatfs(fd int, stat *Statfs_t) (err error) //sys Fsync(fd int) (err error) //sys Ftruncate(fd int, length int64) (err error) -//sys getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) -//sys getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) +//sys getdirentries(fd int, buf []byte, basep *uint64) (n int, err error) //sys Getdtablesize() (size int) //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) @@ -627,19 +372,16 @@ func PtraceSingleStep(pid int) (err error) { //sys Link(path string, link string) (err error) //sys Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) //sys Listen(s int, backlog int) (err error) -//sys lstat(path string, stat *stat_freebsd11_t) (err error) //sys Mkdir(path string, mode uint32) (err error) //sys Mkdirat(dirfd int, path string, mode uint32) (err error) //sys Mkfifo(path string, mode uint32) (err error) -//sys mknod(path string, mode uint32, dev int) (err error) -//sys mknodat(fd int, path string, mode uint32, dev int) (err error) -//sys mknodat_freebsd12(fd int, path string, mode uint32, dev uint64) (err error) +//sys Mknodat(fd int, path string, mode uint32, dev uint64) (err error) //sys Nanosleep(time *Timespec, leftover *Timespec) (err error) //sys Open(path string, mode int, perm uint32) (fd int, err error) //sys Openat(fdat int, path string, mode int, perm uint32) (fd int, err error) //sys Pathconf(path string, name int) (val int, err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Readlink(path string, buf []byte) (n int, err error) //sys Readlinkat(dirfd int, path string, buf []byte) (n int, err error) @@ -663,9 +405,7 @@ func PtraceSingleStep(pid int) (err error) { //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) -//sys stat(path string, stat *stat_freebsd11_t) (err error) -//sys statfs(path string, stat *statfs_freebsd11_t) (err error) -//sys statfs_freebsd12(path string, stat *Statfs_t) (err error) +//sys Statfs(path string, stat *Statfs_t) (err error) //sys Symlink(path string, link string) (err error) //sys Symlinkat(oldpath string, newdirfd int, newpath string) (err error) //sys Sync() (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go index 342fc32b..c3c4c698 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go @@ -57,11 +57,11 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceGetFsBase(pid int, fsbase *int64) (err error) { - return ptrace(PTRACE_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0) + return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0) } func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)} - err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) + err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go index a32d5aa4..82be61a2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go @@ -57,11 +57,11 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) func PtraceGetFsBase(pid int, fsbase *int64) (err error) { - return ptrace(PTRACE_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0) + return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0) } func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} - err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) + err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go index 1e36d39a..cd58f102 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go @@ -58,6 +58,6 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)} - err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) + err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go index a09a1537..d6f538f9 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go @@ -58,6 +58,6 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} - err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) + err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) return int(ioDesc.Len), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go new file mode 100644 index 00000000..8ea6e961 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go @@ -0,0 +1,63 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build riscv64 && freebsd +// +build riscv64,freebsd + +package unix + +import ( + "syscall" + "unsafe" +) + +func setTimespec(sec, nsec int64) Timespec { + return Timespec{Sec: sec, Nsec: nsec} +} + +func setTimeval(sec, usec int64) Timeval { + return Timeval{Sec: sec, Usec: usec} +} + +func SetKevent(k *Kevent_t, fd, mode, flags int) { + k.Ident = uint64(fd) + k.Filter = int16(mode) + k.Flags = uint16(flags) +} + +func (iov *Iovec) SetLen(length int) { + iov.Len = uint64(length) +} + +func (msghdr *Msghdr) SetControllen(length int) { + msghdr.Controllen = uint32(length) +} + +func (msghdr *Msghdr) SetIovlen(length int) { + msghdr.Iovlen = int32(length) +} + +func (cmsg *Cmsghdr) SetLen(length int) { + cmsg.Len = uint32(length) +} + +func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { + var writtenOut uint64 = 0 + _, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0) + + written = int(writtenOut) + + if e1 != 0 { + err = e1 + } + return +} + +func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) + +func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) { + ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)} + err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0) + return int(ioDesc.Len), err +} diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index 8d5f294c..e48244a9 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -20,10 +20,9 @@ func bytes2iovec(bs [][]byte) []Iovec { for i, b := range bs { iovecs[i].SetLen(len(b)) if len(b) > 0 { - // somehow Iovec.Base on illumos is (*int8), not (*byte) - iovecs[i].Base = (*int8)(unsafe.Pointer(&b[0])) + iovecs[i].Base = &b[0] } else { - iovecs[i].Base = (*int8)(unsafe.Pointer(&_zero)) + iovecs[i].Base = (*byte)(unsafe.Pointer(&_zero)) } } return iovecs diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index f432b068..5e4a94f7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -14,6 +14,7 @@ package unix import ( "encoding/binary" "syscall" + "time" "unsafe" ) @@ -249,6 +250,13 @@ func Getwd() (wd string, err error) { if n < 1 || n > len(buf) || buf[n-1] != 0 { return "", EINVAL } + // In some cases, Linux can return a path that starts with the + // "(unreachable)" prefix, which can potentially be a valid relative + // path. To work around that, return ENOENT if path is not absolute. + if buf[0] != '/' { + return "", ENOENT + } + return string(buf[0 : n-1]), nil } @@ -358,6 +366,8 @@ func Wait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, return } +//sys Waitid(idType int, id int, info *Siginfo, options int, rusage *Rusage) (err error) + func Mkfifo(path string, mode uint32) error { return Mknod(path, mode|S_IFIFO, 0) } @@ -502,24 +512,24 @@ func (sa *SockaddrL2) sockaddr() (unsafe.Pointer, _Socklen, error) { // // Server example: // -// fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM) -// _ = unix.Bind(fd, &unix.SockaddrRFCOMM{ -// Channel: 1, -// Addr: [6]uint8{0, 0, 0, 0, 0, 0}, // BDADDR_ANY or 00:00:00:00:00:00 -// }) -// _ = Listen(fd, 1) -// nfd, sa, _ := Accept(fd) -// fmt.Printf("conn addr=%v fd=%d", sa.(*unix.SockaddrRFCOMM).Addr, nfd) -// Read(nfd, buf) +// fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM) +// _ = unix.Bind(fd, &unix.SockaddrRFCOMM{ +// Channel: 1, +// Addr: [6]uint8{0, 0, 0, 0, 0, 0}, // BDADDR_ANY or 00:00:00:00:00:00 +// }) +// _ = Listen(fd, 1) +// nfd, sa, _ := Accept(fd) +// fmt.Printf("conn addr=%v fd=%d", sa.(*unix.SockaddrRFCOMM).Addr, nfd) +// Read(nfd, buf) // // Client example: // -// fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM) -// _ = Connect(fd, &SockaddrRFCOMM{ -// Channel: 1, -// Addr: [6]byte{0x11, 0x22, 0x33, 0xaa, 0xbb, 0xcc}, // CC:BB:AA:33:22:11 -// }) -// Write(fd, []byte(`hello`)) +// fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM) +// _ = Connect(fd, &SockaddrRFCOMM{ +// Channel: 1, +// Addr: [6]byte{0x11, 0x22, 0x33, 0xaa, 0xbb, 0xcc}, // CC:BB:AA:33:22:11 +// }) +// Write(fd, []byte(`hello`)) type SockaddrRFCOMM struct { // Addr represents a bluetooth address, byte ordering is little-endian. Addr [6]uint8 @@ -546,12 +556,12 @@ func (sa *SockaddrRFCOMM) sockaddr() (unsafe.Pointer, _Socklen, error) { // The SockaddrCAN struct must be bound to the socket file descriptor // using Bind before the CAN socket can be used. // -// // Read one raw CAN frame -// fd, _ := Socket(AF_CAN, SOCK_RAW, CAN_RAW) -// addr := &SockaddrCAN{Ifindex: index} -// Bind(fd, addr) -// frame := make([]byte, 16) -// Read(fd, frame) +// // Read one raw CAN frame +// fd, _ := Socket(AF_CAN, SOCK_RAW, CAN_RAW) +// addr := &SockaddrCAN{Ifindex: index} +// Bind(fd, addr) +// frame := make([]byte, 16) +// Read(fd, frame) // // The full SocketCAN documentation can be found in the linux kernel // archives at: https://www.kernel.org/doc/Documentation/networking/can.txt @@ -622,13 +632,13 @@ func (sa *SockaddrCANJ1939) sockaddr() (unsafe.Pointer, _Socklen, error) { // Here is an example of using an AF_ALG socket with SHA1 hashing. // The initial socket setup process is as follows: // -// // Open a socket to perform SHA1 hashing. -// fd, _ := unix.Socket(unix.AF_ALG, unix.SOCK_SEQPACKET, 0) -// addr := &unix.SockaddrALG{Type: "hash", Name: "sha1"} -// unix.Bind(fd, addr) -// // Note: unix.Accept does not work at this time; must invoke accept() -// // manually using unix.Syscall. -// hashfd, _, _ := unix.Syscall(unix.SYS_ACCEPT, uintptr(fd), 0, 0) +// // Open a socket to perform SHA1 hashing. +// fd, _ := unix.Socket(unix.AF_ALG, unix.SOCK_SEQPACKET, 0) +// addr := &unix.SockaddrALG{Type: "hash", Name: "sha1"} +// unix.Bind(fd, addr) +// // Note: unix.Accept does not work at this time; must invoke accept() +// // manually using unix.Syscall. +// hashfd, _, _ := unix.Syscall(unix.SYS_ACCEPT, uintptr(fd), 0, 0) // // Once a file descriptor has been returned from Accept, it may be used to // perform SHA1 hashing. The descriptor is not safe for concurrent use, but @@ -637,39 +647,39 @@ func (sa *SockaddrCANJ1939) sockaddr() (unsafe.Pointer, _Socklen, error) { // When hashing a small byte slice or string, a single Write and Read may // be used: // -// // Assume hashfd is already configured using the setup process. -// hash := os.NewFile(hashfd, "sha1") -// // Hash an input string and read the results. Each Write discards -// // previous hash state. Read always reads the current state. -// b := make([]byte, 20) -// for i := 0; i < 2; i++ { -// io.WriteString(hash, "Hello, world.") -// hash.Read(b) -// fmt.Println(hex.EncodeToString(b)) -// } -// // Output: -// // 2ae01472317d1935a84797ec1983ae243fc6aa28 -// // 2ae01472317d1935a84797ec1983ae243fc6aa28 +// // Assume hashfd is already configured using the setup process. +// hash := os.NewFile(hashfd, "sha1") +// // Hash an input string and read the results. Each Write discards +// // previous hash state. Read always reads the current state. +// b := make([]byte, 20) +// for i := 0; i < 2; i++ { +// io.WriteString(hash, "Hello, world.") +// hash.Read(b) +// fmt.Println(hex.EncodeToString(b)) +// } +// // Output: +// // 2ae01472317d1935a84797ec1983ae243fc6aa28 +// // 2ae01472317d1935a84797ec1983ae243fc6aa28 // // For hashing larger byte slices, or byte streams such as those read from // a file or socket, use Sendto with MSG_MORE to instruct the kernel to update // the hash digest instead of creating a new one for a given chunk and finalizing it. // -// // Assume hashfd and addr are already configured using the setup process. -// hash := os.NewFile(hashfd, "sha1") -// // Hash the contents of a file. -// f, _ := os.Open("/tmp/linux-4.10-rc7.tar.xz") -// b := make([]byte, 4096) -// for { -// n, err := f.Read(b) -// if err == io.EOF { -// break -// } -// unix.Sendto(hashfd, b[:n], unix.MSG_MORE, addr) -// } -// hash.Read(b) -// fmt.Println(hex.EncodeToString(b)) -// // Output: 85cdcad0c06eef66f805ecce353bec9accbeecc5 +// // Assume hashfd and addr are already configured using the setup process. +// hash := os.NewFile(hashfd, "sha1") +// // Hash the contents of a file. +// f, _ := os.Open("/tmp/linux-4.10-rc7.tar.xz") +// b := make([]byte, 4096) +// for { +// n, err := f.Read(b) +// if err == io.EOF { +// break +// } +// unix.Sendto(hashfd, b[:n], unix.MSG_MORE, addr) +// } +// hash.Read(b) +// fmt.Println(hex.EncodeToString(b)) +// // Output: 85cdcad0c06eef66f805ecce353bec9accbeecc5 // // For more information, see: http://www.chronox.de/crypto-API/crypto/userspace-if.html. type SockaddrALG struct { @@ -1489,19 +1499,13 @@ func KeyctlRestrictKeyring(ringid int, keyType string, restriction string) error //sys keyctlRestrictKeyringByType(cmd int, arg2 int, keyType string, restriction string) (err error) = SYS_KEYCTL //sys keyctlRestrictKeyring(cmd int, arg2 int) (err error) = SYS_KEYCTL -func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { var msg Msghdr - var rsa RawSockaddrAny - msg.Name = (*byte)(unsafe.Pointer(&rsa)) + msg.Name = (*byte)(unsafe.Pointer(rsa)) msg.Namelen = uint32(SizeofSockaddrAny) - var iov Iovec - if len(p) > 0 { - iov.Base = &p[0] - iov.SetLen(len(p)) - } var dummy byte if len(oob) > 0 { - if len(p) == 0 { + if emptyIovecs(iov) { var sockType int sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE) if err != nil { @@ -1509,53 +1513,36 @@ func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from } // receive at least one normal byte if sockType != SOCK_DGRAM { - iov.Base = &dummy - iov.SetLen(1) + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } } msg.Control = &oob[0] msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = recvmsg(fd, &msg, flags); err != nil { return } oobn = int(msg.Controllen) recvflags = int(msg.Flags) - // source address is only specified if the socket is unconnected - if rsa.Addr.Family != AF_UNSPEC { - from, err = anyToSockaddr(fd, &rsa) - } return } -func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { - _, err = SendmsgN(fd, p, oob, to, flags) - return -} - -func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { - var ptr unsafe.Pointer - var salen _Socklen - if to != nil { - var err error - ptr, salen, err = to.sockaddr() - if err != nil { - return 0, err - } - } +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { var msg Msghdr msg.Name = (*byte)(ptr) msg.Namelen = uint32(salen) - var iov Iovec - if len(p) > 0 { - iov.Base = &p[0] - iov.SetLen(len(p)) - } var dummy byte + var empty bool if len(oob) > 0 { - if len(p) == 0 { + empty := emptyIovecs(iov) + if empty { var sockType int sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE) if err != nil { @@ -1563,19 +1550,22 @@ func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) } // send at least one normal byte if sockType != SOCK_DGRAM { - iov.Base = &dummy - iov.SetLen(1) + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) } } msg.Control = &oob[0] msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = sendmsg(fd, &msg, flags); err != nil { return 0, err } - if len(oob) > 0 && len(p) == 0 { + if len(oob) > 0 && empty { n = 0 } return n, nil @@ -1838,6 +1828,9 @@ func Dup2(oldfd, newfd int) error { //sys Fremovexattr(fd int, attr string) (err error) //sys Fsetxattr(fd int, attr string, dest []byte, flags int) (err error) //sys Fsync(fd int) (err error) +//sys Fsmount(fd int, flags int, mountAttrs int) (fsfd int, err error) +//sys Fsopen(fsName string, flags int) (fd int, err error) +//sys Fspick(dirfd int, pathName string, flags int) (fd int, err error) //sys Getdents(fd int, buf []byte) (n int, err error) = SYS_GETDENTS64 //sysnb Getpgid(pid int) (pgid int, err error) @@ -1868,7 +1861,9 @@ func Getpgrp() (pid int) { //sys MemfdCreate(name string, flags int) (fd int, err error) //sys Mkdirat(dirfd int, path string, mode uint32) (err error) //sys Mknodat(dirfd int, path string, mode uint32, dev int) (err error) +//sys MoveMount(fromDirfd int, fromPathName string, toDirfd int, toPathName string, flags int) (err error) //sys Nanosleep(time *Timespec, leftover *Timespec) (err error) +//sys OpenTree(dfd int, fileName string, flags uint) (r int, err error) //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT //sysnb Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT64 @@ -2193,7 +2188,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { gid = Getgid() } - if uint32(gid) == st.Gid || isGroupMember(gid) { + if uint32(gid) == st.Gid || isGroupMember(int(st.Gid)) { fmode = (st.Mode >> 3) & 7 } else { fmode = st.Mode & 7 @@ -2308,17 +2303,63 @@ type RemoteIovec struct { //sys PidfdOpen(pid int, flags int) (fd int, err error) = SYS_PIDFD_OPEN //sys PidfdGetfd(pidfd int, targetfd int, flags int) (fd int, err error) = SYS_PIDFD_GETFD +//sys PidfdSendSignal(pidfd int, sig Signal, info *Siginfo, flags int) (err error) = SYS_PIDFD_SEND_SIGNAL //sys shmat(id int, addr uintptr, flag int) (ret uintptr, err error) //sys shmctl(id int, cmd int, buf *SysvShmDesc) (result int, err error) //sys shmdt(addr uintptr) (err error) //sys shmget(key int, size int, flag int) (id int, err error) +//sys getitimer(which int, currValue *Itimerval) (err error) +//sys setitimer(which int, newValue *Itimerval, oldValue *Itimerval) (err error) + +// MakeItimerval creates an Itimerval from interval and value durations. +func MakeItimerval(interval, value time.Duration) Itimerval { + return Itimerval{ + Interval: NsecToTimeval(interval.Nanoseconds()), + Value: NsecToTimeval(value.Nanoseconds()), + } +} + +// A value which may be passed to the which parameter for Getitimer and +// Setitimer. +type ItimerWhich int + +// Possible which values for Getitimer and Setitimer. +const ( + ItimerReal ItimerWhich = ITIMER_REAL + ItimerVirtual ItimerWhich = ITIMER_VIRTUAL + ItimerProf ItimerWhich = ITIMER_PROF +) + +// Getitimer wraps getitimer(2) to return the current value of the timer +// specified by which. +func Getitimer(which ItimerWhich) (Itimerval, error) { + var it Itimerval + if err := getitimer(int(which), &it); err != nil { + return Itimerval{}, err + } + + return it, nil +} + +// Setitimer wraps setitimer(2) to arm or disarm the timer specified by which. +// It returns the previous value of the timer. +// +// If the Itimerval argument is the zero value, the timer will be disarmed. +func Setitimer(which ItimerWhich, it Itimerval) (Itimerval, error) { + var prev Itimerval + if err := setitimer(int(which), &it, &prev); err != nil { + return Itimerval{}, err + } + + return prev, nil +} + /* * Unimplemented */ // AfsSyscall -// Alarm // ArchPrctl // Brk // ClockNanosleep @@ -2334,7 +2375,6 @@ type RemoteIovec struct { // GetMempolicy // GetRobustList // GetThreadArea -// Getitimer // Getpmsg // IoCancel // IoDestroy @@ -2412,5 +2452,4 @@ type RemoteIovec struct { // Vfork // Vhangup // Vserver -// Waitid // _Sysctl diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index 5f757e8a..518e476e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -35,8 +35,8 @@ func setTimeval(sec, usec int64) Timeval { //sys Iopl(level int) (err error) //sys Lchown(path string, uid int, gid int) (err error) = SYS_LCHOWN32 //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64 //sys setfsgid(gid int) (prev int, err error) = SYS_SETFSGID32 @@ -173,14 +173,6 @@ const ( _SENDMMSG = 20 ) -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - fd, e := socketcall(_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) - if e != 0 { - err = e - } - return -} - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { fd, e := socketcall(_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) if e != 0 { diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go new file mode 100644 index 00000000..08086ac6 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go @@ -0,0 +1,14 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux && (386 || amd64 || mips || mipsle || mips64 || mipsle || ppc64 || ppc64le || ppc || s390x || sparc64) +// +build linux +// +build 386 amd64 mips mipsle mips64 mipsle ppc64 ppc64le ppc s390x sparc64 + +package unix + +// SYS_ALARM is not defined on arm or riscv, but is available for other GOARCH +// values. + +//sys Alarm(seconds uint) (remaining uint, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 4299125a..f5e9d6be 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -28,9 +28,10 @@ func Lstat(path string, stat *Stat_t) (err error) { return Fstatat(AT_FDCWD, path, stat, AT_SYMLINK_NOFOLLOW) } +//sys MemfdSecret(flags int) (fd int, err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK @@ -62,7 +63,6 @@ func Stat(path string, stat *Stat_t) (err error) { //sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) //sys Truncate(path string, length int64) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index 79edeb9c..c1a7778f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -27,7 +27,6 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { return newoffset, nil } -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) @@ -97,8 +96,8 @@ func Utime(path string, buf *Utimbuf) error { //sys utimes(path string, times *[2]Timeval) (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Truncate(path string, length int64) (err error) = SYS_TRUNCATE64 //sys Ftruncate(fd int, length int64) (err error) = SYS_FTRUNCATE64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index 862890de..d83e2c65 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -22,8 +22,9 @@ import "unsafe" //sysnb getrlimit(resource int, rlim *Rlimit) (err error) //sysnb Getuid() (uid int) //sys Listen(s int, n int) (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys MemfdSecret(flags int) (fd int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK @@ -66,7 +67,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { return ENOSYS } -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go new file mode 100644 index 00000000..0b69c3ef --- /dev/null +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -0,0 +1,226 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build loong64 && linux +// +build loong64,linux + +package unix + +import "unsafe" + +//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_PWAIT +//sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 +//sys Fchown(fd int, uid int, gid int) (err error) +//sys Fstatfs(fd int, buf *Statfs_t) (err error) +//sys Ftruncate(fd int, length int64) (err error) +//sysnb Getegid() (egid int) +//sysnb Geteuid() (euid int) +//sysnb Getgid() (gid int) +//sysnb Getuid() (uid int) +//sys Listen(s int, n int) (err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK + +func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { + var ts *Timespec + if timeout != nil { + ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} + } + return Pselect(nfd, r, w, e, ts, nil) +} + +//sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) +//sys setfsgid(gid int) (prev int, err error) +//sys setfsuid(uid int) (prev int, err error) +//sysnb Setregid(rgid int, egid int) (err error) +//sysnb Setresgid(rgid int, egid int, sgid int) (err error) +//sysnb Setresuid(ruid int, euid int, suid int) (err error) +//sysnb Setreuid(ruid int, euid int) (err error) +//sys Shutdown(fd int, how int) (err error) +//sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) + +func timespecFromStatxTimestamp(x StatxTimestamp) Timespec { + return Timespec{ + Sec: x.Sec, + Nsec: int64(x.Nsec), + } +} + +func Fstatat(fd int, path string, stat *Stat_t, flags int) error { + var r Statx_t + // Do it the glibc way, add AT_NO_AUTOMOUNT. + if err := Statx(fd, path, AT_NO_AUTOMOUNT|flags, STATX_BASIC_STATS, &r); err != nil { + return err + } + + stat.Dev = Mkdev(r.Dev_major, r.Dev_minor) + stat.Ino = r.Ino + stat.Mode = uint32(r.Mode) + stat.Nlink = r.Nlink + stat.Uid = r.Uid + stat.Gid = r.Gid + stat.Rdev = Mkdev(r.Rdev_major, r.Rdev_minor) + // hope we don't get to process files so large to overflow these size + // fields... + stat.Size = int64(r.Size) + stat.Blksize = int32(r.Blksize) + stat.Blocks = int64(r.Blocks) + stat.Atim = timespecFromStatxTimestamp(r.Atime) + stat.Mtim = timespecFromStatxTimestamp(r.Mtime) + stat.Ctim = timespecFromStatxTimestamp(r.Ctime) + + return nil +} + +func Fstat(fd int, stat *Stat_t) (err error) { + return Fstatat(fd, "", stat, AT_EMPTY_PATH) +} + +func Stat(path string, stat *Stat_t) (err error) { + return Fstatat(AT_FDCWD, path, stat, 0) +} + +func Lchown(path string, uid int, gid int) (err error) { + return Fchownat(AT_FDCWD, path, uid, gid, AT_SYMLINK_NOFOLLOW) +} + +func Lstat(path string, stat *Stat_t) (err error) { + return Fstatat(AT_FDCWD, path, stat, AT_SYMLINK_NOFOLLOW) +} + +//sys Statfs(path string, buf *Statfs_t) (err error) +//sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) +//sys Truncate(path string, length int64) (err error) + +func Ustat(dev int, ubuf *Ustat_t) (err error) { + return ENOSYS +} + +//sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) +//sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) +//sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) +//sysnb getgroups(n int, list *_Gid_t) (nn int, err error) +//sysnb setgroups(n int, list *_Gid_t) (err error) +//sys getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) +//sys setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) +//sysnb socket(domain int, typ int, proto int) (fd int, err error) +//sysnb socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) +//sysnb getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) +//sysnb getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) +//sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) +//sys sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) +//sys recvmsg(s int, msg *Msghdr, flags int) (n int, err error) +//sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) +//sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) + +//sysnb Gettimeofday(tv *Timeval) (err error) + +func setTimespec(sec, nsec int64) Timespec { + return Timespec{Sec: sec, Nsec: nsec} +} + +func setTimeval(sec, usec int64) Timeval { + return Timeval{Sec: sec, Usec: usec} +} + +func Getrlimit(resource int, rlim *Rlimit) (err error) { + err = Prlimit(0, resource, nil, rlim) + return +} + +func Setrlimit(resource int, rlim *Rlimit) (err error) { + err = Prlimit(0, resource, rlim, nil) + return +} + +func futimesat(dirfd int, path string, tv *[2]Timeval) (err error) { + if tv == nil { + return utimensat(dirfd, path, nil, 0) + } + + ts := []Timespec{ + NsecToTimespec(TimevalToNsec(tv[0])), + NsecToTimespec(TimevalToNsec(tv[1])), + } + return utimensat(dirfd, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), 0) +} + +func Time(t *Time_t) (Time_t, error) { + var tv Timeval + err := Gettimeofday(&tv) + if err != nil { + return 0, err + } + if t != nil { + *t = Time_t(tv.Sec) + } + return Time_t(tv.Sec), nil +} + +func Utime(path string, buf *Utimbuf) error { + tv := []Timeval{ + {Sec: buf.Actime}, + {Sec: buf.Modtime}, + } + return Utimes(path, tv) +} + +func utimes(path string, tv *[2]Timeval) (err error) { + if tv == nil { + return utimensat(AT_FDCWD, path, nil, 0) + } + + ts := []Timespec{ + NsecToTimespec(TimevalToNsec(tv[0])), + NsecToTimespec(TimevalToNsec(tv[1])), + } + return utimensat(AT_FDCWD, path, (*[2]Timespec)(unsafe.Pointer(&ts[0])), 0) +} + +func (r *PtraceRegs) PC() uint64 { return r.Era } + +func (r *PtraceRegs) SetPC(era uint64) { r.Era = era } + +func (iov *Iovec) SetLen(length int) { + iov.Len = uint64(length) +} + +func (msghdr *Msghdr) SetControllen(length int) { + msghdr.Controllen = uint64(length) +} + +func (msghdr *Msghdr) SetIovlen(length int) { + msghdr.Iovlen = uint64(length) +} + +func (cmsg *Cmsghdr) SetLen(length int) { + cmsg.Len = uint64(length) +} + +func (rsa *RawSockaddrNFCLLCP) SetServiceNameLen(length int) { + rsa.Service_name_len = uint64(length) +} + +func Pause() error { + _, err := ppoll(nil, 0, nil, nil) + return err +} + +func Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) { + return Renameat2(olddirfd, oldpath, newdirfd, newpath, 0) +} + +//sys kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, flags int) (err error) + +func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error { + cmdlineLen := len(cmdline) + if cmdlineLen > 0 { + // Account for the additional NULL byte added by + // BytePtrFromString in kexecFileLoad. The kexec_file_load + // syscall expects a NULL-terminated string. + cmdlineLen++ + } + return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 8932e34a..98a2660b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -21,8 +21,8 @@ package unix //sys Lchown(path string, uid int, gid int) (err error) //sys Listen(s int, n int) (err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK @@ -48,7 +48,6 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) //sys Truncate(path string, length int64) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index 7821c25d..b8a18c0a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -25,8 +25,8 @@ func Syscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sysnb Getuid() (uid int) //sys Lchown(path string, uid int, gid int) (err error) //sys Listen(s int, n int) (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) = SYS__NEWSELECT //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64 @@ -41,7 +41,6 @@ func Syscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) //sys Truncate(path string, length int64) (err error) = SYS_TRUNCATE64 //sys Ustat(dev int, ubuf *Ustat_t) (err error) -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index c5053a0f..4ed9e67c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -27,8 +27,8 @@ import ( //sys Listen(s int, n int) (err error) //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) = SYS__NEWSELECT //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64 @@ -43,7 +43,6 @@ import ( //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys Truncate(path string, length int64) (err error) = SYS_TRUNCATE64 //sys Ustat(dev int, ubuf *Ustat_t) (err error) -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index 25786c42..db63d384 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -26,8 +26,8 @@ package unix //sys Listen(s int, n int) (err error) //sys Lstat(path string, stat *Stat_t) (err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) = SYS__NEWSELECT @@ -45,7 +45,6 @@ package unix //sys Statfs(path string, buf *Statfs_t) (err error) //sys Truncate(path string, length int64) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 6f9f7104..925a748a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -22,8 +22,9 @@ import "unsafe" //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) //sysnb Getuid() (uid int) //sys Listen(s int, n int) (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys MemfdSecret(flags int) (fd int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { @@ -65,7 +66,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { return ENOSYS } -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index 6aa59cb2..6fcf277b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -26,8 +26,8 @@ import ( //sys Lchown(path string, uid int, gid int) (err error) //sys Lstat(path string, stat *Stat_t) (err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) @@ -145,15 +145,6 @@ const ( netSendMMsg = 20 ) -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (int, error) { - args := [3]uintptr{uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))} - fd, _, err := Syscall(SYS_SOCKETCALL, netAccept, uintptr(unsafe.Pointer(&args)), 0) - if err != 0 { - return 0, err - } - return int(fd), nil -} - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (int, error) { args := [4]uintptr{uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags)} fd, _, err := Syscall(SYS_SOCKETCALL, netAccept4, uintptr(unsafe.Pointer(&args)), 0) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index bbe8d174..02a45d9c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -23,8 +23,8 @@ package unix //sys Listen(s int, n int) (err error) //sys Lstat(path string, stat *Stat_t) (err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 +//sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) @@ -42,7 +42,6 @@ package unix //sys Statfs(path string, buf *Statfs_t) (err error) //sys SyncFileRange(fd int, off int64, n int64, flags int) (err error) //sys Truncate(path string, length int64) (err error) -//sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) //sys accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) //sys bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) //sys connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index 696fed49..666f0a1b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -163,11 +163,6 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e return -1, ENOSYS } -func setattrlistTimes(path string, times []Timespec, flags int) error { - // used on Darwin for UtimesNano - return ENOSYS -} - //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL @@ -313,8 +308,8 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys Open(path string, mode int, perm uint32) (fd int, err error) //sys Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) //sys Pathconf(path string, name int) (val int, err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Readlink(path string, buf []byte) (n int, err error) //sys Readlinkat(dirfd int, path string, buf []byte) (n int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index 11b1d419..78daceb3 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -81,6 +81,7 @@ func Pipe(p []int) (err error) { } //sysnb pipe2(p *[2]_C_int, flags int) (err error) + func Pipe2(p []int, flags int) error { if len(p) != 2 { return EINVAL @@ -95,6 +96,7 @@ func Pipe2(p []int, flags int) error { } //sys Getdents(fd int, buf []byte) (n int, err error) + func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { n, err = Getdents(fd, buf) if err != nil || basep == nil { @@ -149,11 +151,6 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } -func setattrlistTimes(path string, times []Timespec, flags int) error { - // used on Darwin for UtimesNano - return ENOSYS -} - //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL @@ -274,8 +271,8 @@ func Uname(uname *Utsname) error { //sys Open(path string, mode int, perm uint32) (fd int, err error) //sys Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) //sys Pathconf(path string, name int) (val int, err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Readlink(path string, buf []byte) (n int, err error) //sys Readlinkat(dirfd int, path string, buf []byte) (n int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go index 30f28534..1378489f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go @@ -26,6 +26,10 @@ func (msghdr *Msghdr) SetControllen(length int) { msghdr.Controllen = uint32(length) } +func (msghdr *Msghdr) SetIovlen(length int) { + msghdr.Iovlen = uint32(length) +} + func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index 5c813921..b5ec457c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -451,77 +451,59 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) { //sys recvmsg(s int, msg *Msghdr, flags int) (n int, err error) = libsocket.__xnet_recvmsg -func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { var msg Msghdr - var rsa RawSockaddrAny - msg.Name = (*byte)(unsafe.Pointer(&rsa)) + msg.Name = (*byte)(unsafe.Pointer(rsa)) msg.Namelen = uint32(SizeofSockaddrAny) - var iov Iovec - if len(p) > 0 { - iov.Base = (*int8)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } - var dummy int8 + var dummy byte if len(oob) > 0 { // receive at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + if emptyIovecs(iov) { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Accrightslen = int32(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = recvmsg(fd, &msg, flags); n == -1 { return } oobn = int(msg.Accrightslen) - // source address is only specified if the socket is unconnected - if rsa.Addr.Family != AF_UNSPEC { - from, err = anyToSockaddr(fd, &rsa) - } - return -} - -func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { - _, err = SendmsgN(fd, p, oob, to, flags) return } //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = libsocket.__xnet_sendmsg -func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { - var ptr unsafe.Pointer - var salen _Socklen - if to != nil { - ptr, salen, err = to.sockaddr() - if err != nil { - return 0, err - } - } +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(ptr)) msg.Namelen = uint32(salen) - var iov Iovec - if len(p) > 0 { - iov.Base = (*int8)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } - var dummy int8 + var dummy byte + var empty bool if len(oob) > 0 { // send at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + empty = emptyIovecs(iov) + if empty { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Accrightslen = int32(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = sendmsg(fd, &msg, flags); err != nil { return 0, err } - if len(oob) > 0 && len(p) == 0 { + if len(oob) > 0 && empty { n = 0 } return n, nil @@ -636,6 +618,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Getpriority(which int, who int) (n int, err error) //sysnb Getrlimit(which int, lim *Rlimit) (err error) //sysnb Getrusage(who int, rusage *Rusage) (err error) +//sysnb Getsid(pid int) (sid int, err error) //sysnb Gettimeofday(tv *Timeval) (err error) //sysnb Getuid() (uid int) //sys Kill(pid int, signum syscall.Signal) (err error) @@ -661,8 +644,8 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) //sys Pathconf(path string, name int) (val int, err error) //sys Pause() (err error) -//sys Pread(fd int, p []byte, offset int64) (n int, err error) -//sys Pwrite(fd int, p []byte, offset int64) (n int, err error) +//sys pread(fd int, p []byte, offset int64) (n int, err error) +//sys pwrite(fd int, p []byte, offset int64) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Readlink(path string, buf []byte) (n int, err error) //sys Rename(from string, to string) (err error) @@ -755,8 +738,20 @@ type fileObjCookie struct { type EventPort struct { port int mu sync.Mutex - fds map[uintptr]interface{} + fds map[uintptr]*fileObjCookie paths map[string]*fileObjCookie + // The user cookie presents an interesting challenge from a memory management perspective. + // There are two paths by which we can discover that it is no longer in use: + // 1. The user calls port_dissociate before any events fire + // 2. An event fires and we return it to the user + // The tricky situation is if the event has fired in the kernel but + // the user hasn't requested/received it yet. + // If the user wants to port_dissociate before the event has been processed, + // we should handle things gracefully. To do so, we need to keep an extra + // reference to the cookie around until the event is processed + // thus the otherwise seemingly extraneous "cookies" map + // The key of this map is a pointer to the corresponding &fCookie.cookie + cookies map[*interface{}]*fileObjCookie } // PortEvent is an abstraction of the port_event C struct. @@ -780,9 +775,10 @@ func NewEventPort() (*EventPort, error) { return nil, err } e := &EventPort{ - port: port, - fds: make(map[uintptr]interface{}), - paths: make(map[string]*fileObjCookie), + port: port, + fds: make(map[uintptr]*fileObjCookie), + paths: make(map[string]*fileObjCookie), + cookies: make(map[*interface{}]*fileObjCookie), } return e, nil } @@ -797,9 +793,13 @@ func NewEventPort() (*EventPort, error) { func (e *EventPort) Close() error { e.mu.Lock() defer e.mu.Unlock() + err := Close(e.port) + if err != nil { + return err + } e.fds = nil e.paths = nil - return Close(e.port) + return nil } // PathIsWatched checks to see if path is associated with this EventPort. @@ -836,6 +836,7 @@ func (e *EventPort) AssociatePath(path string, stat os.FileInfo, events int, coo return err } e.paths[path] = fCookie + e.cookies[&fCookie.cookie] = fCookie return nil } @@ -848,11 +849,19 @@ func (e *EventPort) DissociatePath(path string) error { return fmt.Errorf("%v is not associated with this Event Port", path) } _, err := port_dissociate(e.port, PORT_SOURCE_FILE, uintptr(unsafe.Pointer(f.fobj))) - if err != nil { + // If the path is no longer associated with this event port (ENOENT) + // we should delete it from our map. We can still return ENOENT to the caller. + // But we need to save the cookie + if err != nil && err != ENOENT { return err } + if err == nil { + // dissociate was successful, safe to delete the cookie + fCookie := e.paths[path] + delete(e.cookies, &fCookie.cookie) + } delete(e.paths, path) - return nil + return err } // AssociateFd wraps calls to port_associate(3c) on file descriptors. @@ -862,12 +871,13 @@ func (e *EventPort) AssociateFd(fd uintptr, events int, cookie interface{}) erro if _, found := e.fds[fd]; found { return fmt.Errorf("%v is already associated with this Event Port", fd) } - pcookie := &cookie - _, err := port_associate(e.port, PORT_SOURCE_FD, fd, events, (*byte)(unsafe.Pointer(pcookie))) + fCookie := &fileObjCookie{nil, cookie} + _, err := port_associate(e.port, PORT_SOURCE_FD, fd, events, (*byte)(unsafe.Pointer(&fCookie.cookie))) if err != nil { return err } - e.fds[fd] = pcookie + e.fds[fd] = fCookie + e.cookies[&fCookie.cookie] = fCookie return nil } @@ -880,11 +890,16 @@ func (e *EventPort) DissociateFd(fd uintptr) error { return fmt.Errorf("%v is not associated with this Event Port", fd) } _, err := port_dissociate(e.port, PORT_SOURCE_FD, fd) - if err != nil { + if err != nil && err != ENOENT { return err } + if err == nil { + // dissociate was successful, safe to delete the cookie + fCookie := e.fds[fd] + delete(e.cookies, &fCookie.cookie) + } delete(e.fds, fd) - return nil + return err } func createFileObj(name string, stat os.FileInfo) (*fileObj, error) { @@ -912,24 +927,46 @@ func (e *EventPort) GetOne(t *Timespec) (*PortEvent, error) { return nil, err } p := new(PortEvent) - p.Events = pe.Events - p.Source = pe.Source e.mu.Lock() defer e.mu.Unlock() - switch pe.Source { + e.peIntToExt(pe, p) + return p, nil +} + +// peIntToExt converts a cgo portEvent struct into the friendlier PortEvent +// NOTE: Always call this function while holding the e.mu mutex +func (e *EventPort) peIntToExt(peInt *portEvent, peExt *PortEvent) { + peExt.Events = peInt.Events + peExt.Source = peInt.Source + cookie := (*interface{})(unsafe.Pointer(peInt.User)) + peExt.Cookie = *cookie + switch peInt.Source { case PORT_SOURCE_FD: - p.Fd = uintptr(pe.Object) - cookie := (*interface{})(unsafe.Pointer(pe.User)) - p.Cookie = *cookie - delete(e.fds, p.Fd) + delete(e.cookies, cookie) + peExt.Fd = uintptr(peInt.Object) + // Only remove the fds entry if it exists and this cookie matches + if fobj, ok := e.fds[peExt.Fd]; ok { + if &fobj.cookie == cookie { + delete(e.fds, peExt.Fd) + } + } case PORT_SOURCE_FILE: - p.fobj = (*fileObj)(unsafe.Pointer(uintptr(pe.Object))) - p.Path = BytePtrToString((*byte)(unsafe.Pointer(p.fobj.Name))) - cookie := (*interface{})(unsafe.Pointer(pe.User)) - p.Cookie = *cookie - delete(e.paths, p.Path) + if fCookie, ok := e.cookies[cookie]; ok && uintptr(unsafe.Pointer(fCookie.fobj)) == uintptr(peInt.Object) { + // Use our stashed reference rather than using unsafe on what we got back + // the unsafe version would be (*fileObj)(unsafe.Pointer(uintptr(peInt.Object))) + peExt.fobj = fCookie.fobj + } else { + panic("mismanaged memory") + } + delete(e.cookies, cookie) + peExt.Path = BytePtrToString((*byte)(unsafe.Pointer(peExt.fobj.Name))) + // Only remove the paths entry if it exists and this cookie matches + if fobj, ok := e.paths[peExt.Path]; ok { + if &fobj.cookie == cookie { + delete(e.paths, peExt.Path) + } + } } - return p, nil } // Pending wraps port_getn(3c) and returns how many events are pending. @@ -962,21 +999,7 @@ func (e *EventPort) Get(s []PortEvent, min int, timeout *Timespec) (int, error) e.mu.Lock() defer e.mu.Unlock() for i := 0; i < int(got); i++ { - s[i].Events = ps[i].Events - s[i].Source = ps[i].Source - switch ps[i].Source { - case PORT_SOURCE_FD: - s[i].Fd = uintptr(ps[i].Object) - cookie := (*interface{})(unsafe.Pointer(ps[i].User)) - s[i].Cookie = *cookie - delete(e.fds, s[i].Fd) - case PORT_SOURCE_FILE: - s[i].fobj = (*fileObj)(unsafe.Pointer(uintptr(ps[i].Object))) - s[i].Path = BytePtrToString((*byte)(unsafe.Pointer(s[i].fobj.Name))) - cookie := (*interface{})(unsafe.Pointer(ps[i].User)) - s[i].Cookie = *cookie - delete(e.paths, s[i].Path) - } + e.peIntToExt(&ps[i], &s[i]) } return int(got), err } diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index cf296a24..1ff5060b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -177,6 +177,30 @@ func Write(fd int, p []byte) (n int, err error) { return } +func Pread(fd int, p []byte, offset int64) (n int, err error) { + n, err = pread(fd, p, offset) + if raceenabled { + if n > 0 { + raceWriteRange(unsafe.Pointer(&p[0]), n) + } + if err == nil { + raceAcquire(unsafe.Pointer(&ioSync)) + } + } + return +} + +func Pwrite(fd int, p []byte, offset int64) (n int, err error) { + if raceenabled { + raceReleaseMerge(unsafe.Pointer(&ioSync)) + } + n, err = pwrite(fd, p, offset) + if raceenabled && n > 0 { + raceReadRange(unsafe.Pointer(&p[0]), n) + } + return +} + // For testing: clients can set this flag to force // creation of IPv6 sockets to return EAFNOSUPPORT. var SocketDisableIPv6 bool @@ -313,6 +337,93 @@ func Recvfrom(fd int, p []byte, flags int) (n int, from Sockaddr, err error) { return } +func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { + var iov [1]Iovec + if len(p) > 0 { + iov[0].Base = &p[0] + iov[0].SetLen(len(p)) + } + var rsa RawSockaddrAny + n, oobn, recvflags, err = recvmsgRaw(fd, iov[:], oob, flags, &rsa) + // source address is only specified if the socket is unconnected + if rsa.Addr.Family != AF_UNSPEC { + from, err = anyToSockaddr(fd, &rsa) + } + return +} + +// RecvmsgBuffers receives a message from a socket using the recvmsg +// system call. The flags are passed to recvmsg. Any non-control data +// read is scattered into the buffers slices. The results are: +// - n is the number of non-control data read into bufs +// - oobn is the number of control data read into oob; this may be interpreted using [ParseSocketControlMessage] +// - recvflags is flags returned by recvmsg +// - from is the address of the sender +func RecvmsgBuffers(fd int, buffers [][]byte, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { + iov := make([]Iovec, len(buffers)) + for i := range buffers { + if len(buffers[i]) > 0 { + iov[i].Base = &buffers[i][0] + iov[i].SetLen(len(buffers[i])) + } else { + iov[i].Base = (*byte)(unsafe.Pointer(&_zero)) + } + } + var rsa RawSockaddrAny + n, oobn, recvflags, err = recvmsgRaw(fd, iov, oob, flags, &rsa) + if err == nil && rsa.Addr.Family != AF_UNSPEC { + from, err = anyToSockaddr(fd, &rsa) + } + return +} + +func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { + _, err = SendmsgN(fd, p, oob, to, flags) + return +} + +func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { + var iov [1]Iovec + if len(p) > 0 { + iov[0].Base = &p[0] + iov[0].SetLen(len(p)) + } + var ptr unsafe.Pointer + var salen _Socklen + if to != nil { + ptr, salen, err = to.sockaddr() + if err != nil { + return 0, err + } + } + return sendmsgN(fd, iov[:], oob, ptr, salen, flags) +} + +// SendmsgBuffers sends a message on a socket to an address using the sendmsg +// system call. The flags are passed to sendmsg. Any non-control data written +// is gathered from buffers. The function returns the number of bytes written +// to the socket. +func SendmsgBuffers(fd int, buffers [][]byte, oob []byte, to Sockaddr, flags int) (n int, err error) { + iov := make([]Iovec, len(buffers)) + for i := range buffers { + if len(buffers[i]) > 0 { + iov[i].Base = &buffers[i][0] + iov[i].SetLen(len(buffers[i])) + } else { + iov[i].Base = (*byte)(unsafe.Pointer(&_zero)) + } + } + var ptr unsafe.Pointer + var salen _Socklen + if to != nil { + ptr, salen, err = to.sockaddr() + if err != nil { + return 0, err + } + } + return sendmsgN(fd, iov, oob, ptr, salen, flags) +} + func Send(s int, buf []byte, flags int) (err error) { return sendto(s, buf, flags, nil, 0) } @@ -433,3 +544,13 @@ func Lutimes(path string, tv []Timeval) error { } return UtimesNanoAt(AT_FDCWD, path, ts, AT_SYMLINK_NOFOLLOW) } + +// emptyIovec reports whether there are no bytes in the slice of Iovec. +func emptyIovecs(iov []Iovec) bool { + for i := range iov { + if iov[i].Len > 0 { + return false + } + } + return true +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go index 44090011..f8c2c513 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go @@ -151,6 +151,7 @@ const ( BIOCSETF = 0x80084267 BIOCSETFNR = 0x80084282 BIOCSETIF = 0x8020426c + BIOCSETVLANPCP = 0x80044285 BIOCSETWF = 0x8008427b BIOCSETZBUF = 0x800c4281 BIOCSHDRCMPLT = 0x80044275 @@ -447,7 +448,7 @@ const ( DLT_IEEE802_16_MAC_CPS_RADIO = 0xc1 DLT_INFINIBAND = 0xf7 DLT_IPFILTER = 0x74 - DLT_IPMB = 0xc7 + DLT_IPMB_KONTRON = 0xc7 DLT_IPMB_LINUX = 0xd1 DLT_IPMI_HPM_2 = 0x104 DLT_IPNET = 0xe2 @@ -487,10 +488,11 @@ const ( DLT_LINUX_LAPD = 0xb1 DLT_LINUX_PPP_WITHDIRECTION = 0xa6 DLT_LINUX_SLL = 0x71 + DLT_LINUX_SLL2 = 0x114 DLT_LOOP = 0x6c DLT_LORATAP = 0x10e DLT_LTALK = 0x72 - DLT_MATCHING_MAX = 0x113 + DLT_MATCHING_MAX = 0x114 DLT_MATCHING_MIN = 0x68 DLT_MFR = 0xb6 DLT_MOST = 0xd3 @@ -734,6 +736,7 @@ const ( IPPROTO_CMTP = 0x26 IPPROTO_CPHB = 0x49 IPPROTO_CPNX = 0x48 + IPPROTO_DCCP = 0x21 IPPROTO_DDP = 0x25 IPPROTO_DGP = 0x56 IPPROTO_DIVERT = 0x102 @@ -814,7 +817,6 @@ const ( IPPROTO_SCTP = 0x84 IPPROTO_SDRP = 0x2a IPPROTO_SEND = 0x103 - IPPROTO_SEP = 0x21 IPPROTO_SHIM6 = 0x8c IPPROTO_SKIP = 0x39 IPPROTO_SPACER = 0x7fff @@ -911,6 +913,7 @@ const ( IPV6_V6ONLY = 0x1b IPV6_VERSION = 0x60 IPV6_VERSION_MASK = 0xf0 + IPV6_VLAN_PCP = 0x4b IP_ADD_MEMBERSHIP = 0xc IP_ADD_SOURCE_MEMBERSHIP = 0x46 IP_BINDANY = 0x18 @@ -989,8 +992,12 @@ const ( IP_TOS = 0x3 IP_TTL = 0x4 IP_UNBLOCK_SOURCE = 0x49 + IP_VLAN_PCP = 0x4b ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IXANY = 0x800 IXOFF = 0x400 IXON = 0x200 @@ -1000,7 +1007,6 @@ const ( KERN_VERSION = 0x4 LOCAL_CONNWAIT = 0x4 LOCAL_CREDS = 0x2 - LOCAL_CREDS_PERSISTENT = 0x3 LOCAL_PEERCRED = 0x1 LOCAL_VENDOR = 0x80000000 LOCK_EX = 0x2 @@ -1179,6 +1185,8 @@ const ( O_NONBLOCK = 0x4 O_RDONLY = 0x0 O_RDWR = 0x2 + O_RESOLVE_BENEATH = 0x800000 + O_SEARCH = 0x40000 O_SHLOCK = 0x10 O_SYNC = 0x80 O_TRUNC = 0x400 @@ -1189,6 +1197,10 @@ const ( PARMRK = 0x8 PARODD = 0x2000 PENDIN = 0x20000000 + PIOD_READ_D = 0x1 + PIOD_READ_I = 0x3 + PIOD_WRITE_D = 0x2 + PIOD_WRITE_I = 0x4 PRIO_PGRP = 0x1 PRIO_PROCESS = 0x0 PRIO_USER = 0x2 @@ -1196,6 +1208,60 @@ const ( PROT_NONE = 0x0 PROT_READ = 0x1 PROT_WRITE = 0x2 + PTRACE_DEFAULT = 0x1 + PTRACE_EXEC = 0x1 + PTRACE_FORK = 0x8 + PTRACE_LWP = 0x10 + PTRACE_SCE = 0x2 + PTRACE_SCX = 0x4 + PTRACE_SYSCALL = 0x6 + PTRACE_VFORK = 0x20 + PT_ATTACH = 0xa + PT_CLEARSTEP = 0x10 + PT_CONTINUE = 0x7 + PT_DETACH = 0xb + PT_FIRSTMACH = 0x40 + PT_FOLLOW_FORK = 0x17 + PT_GETDBREGS = 0x25 + PT_GETFPREGS = 0x23 + PT_GETFSBASE = 0x47 + PT_GETGSBASE = 0x49 + PT_GETLWPLIST = 0xf + PT_GETNUMLWPS = 0xe + PT_GETREGS = 0x21 + PT_GETXMMREGS = 0x40 + PT_GETXSTATE = 0x45 + PT_GETXSTATE_INFO = 0x44 + PT_GET_EVENT_MASK = 0x19 + PT_GET_SC_ARGS = 0x1b + PT_GET_SC_RET = 0x1c + PT_IO = 0xc + PT_KILL = 0x8 + PT_LWPINFO = 0xd + PT_LWP_EVENTS = 0x18 + PT_READ_D = 0x2 + PT_READ_I = 0x1 + PT_RESUME = 0x13 + PT_SETDBREGS = 0x26 + PT_SETFPREGS = 0x24 + PT_SETFSBASE = 0x48 + PT_SETGSBASE = 0x4a + PT_SETREGS = 0x22 + PT_SETSTEP = 0x11 + PT_SETXMMREGS = 0x41 + PT_SETXSTATE = 0x46 + PT_SET_EVENT_MASK = 0x1a + PT_STEP = 0x9 + PT_SUSPEND = 0x12 + PT_SYSCALL = 0x16 + PT_TO_SCE = 0x14 + PT_TO_SCX = 0x15 + PT_TRACE_ME = 0x0 + PT_VM_ENTRY = 0x29 + PT_VM_TIMESTAMP = 0x28 + PT_WRITE_D = 0x5 + PT_WRITE_I = 0x4 + P_ZONEID = 0xc RLIMIT_AS = 0xa RLIMIT_CORE = 0x4 RLIMIT_CPU = 0x0 @@ -1320,10 +1386,12 @@ const ( SIOCGHWADDR = 0xc020693e SIOCGI2C = 0xc020693d SIOCGIFADDR = 0xc0206921 + SIOCGIFALIAS = 0xc044692d SIOCGIFBRDADDR = 0xc0206923 SIOCGIFCAP = 0xc020691f SIOCGIFCONF = 0xc0086924 SIOCGIFDESCR = 0xc020692a + SIOCGIFDOWNREASON = 0xc058699a SIOCGIFDSTADDR = 0xc0206922 SIOCGIFFIB = 0xc020695c SIOCGIFFLAGS = 0xc0206911 @@ -1414,6 +1482,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 + SO_RERROR = 0x20000 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_REUSEPORT_LB = 0x10000 @@ -1472,22 +1541,40 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_FAST_OPEN = 0x22 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_PAD = 0x0 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_WINDOW = 0x3 TCP_BBR_ACK_COMP_ALG = 0x448 + TCP_BBR_ALGORITHM = 0x43b TCP_BBR_DRAIN_INC_EXTRA = 0x43c TCP_BBR_DRAIN_PG = 0x42e TCP_BBR_EXTRA_GAIN = 0x449 + TCP_BBR_EXTRA_STATE = 0x453 + TCP_BBR_FLOOR_MIN_TSO = 0x454 + TCP_BBR_HDWR_PACE = 0x451 + TCP_BBR_HOLD_TARGET = 0x436 TCP_BBR_IWINTSO = 0x42b TCP_BBR_LOWGAIN_FD = 0x436 TCP_BBR_LOWGAIN_HALF = 0x435 TCP_BBR_LOWGAIN_THRESH = 0x434 TCP_BBR_MAX_RTO = 0x439 TCP_BBR_MIN_RTO = 0x438 + TCP_BBR_MIN_TOPACEOUT = 0x455 TCP_BBR_ONE_RETRAN = 0x431 TCP_BBR_PACE_CROSS = 0x442 TCP_BBR_PACE_DEL_TAR = 0x43f + TCP_BBR_PACE_OH = 0x435 TCP_BBR_PACE_PER_SEC = 0x43e TCP_BBR_PACE_SEG_MAX = 0x440 TCP_BBR_PACE_SEG_MIN = 0x441 + TCP_BBR_POLICER_DETECT = 0x457 TCP_BBR_PROBE_RTT_GAIN = 0x44d TCP_BBR_PROBE_RTT_INT = 0x430 TCP_BBR_PROBE_RTT_LEN = 0x44e @@ -1496,12 +1583,18 @@ const ( TCP_BBR_REC_OVER_HPTS = 0x43a TCP_BBR_RETRAN_WTSO = 0x44b TCP_BBR_RWND_IS_APP = 0x42f + TCP_BBR_SEND_IWND_IN_TSO = 0x44f TCP_BBR_STARTUP_EXIT_EPOCH = 0x43d TCP_BBR_STARTUP_LOSS_EXIT = 0x432 TCP_BBR_STARTUP_PG = 0x42d + TCP_BBR_TMR_PACE_OH = 0x448 + TCP_BBR_TSLIMITS = 0x434 + TCP_BBR_TSTMP_RAISES = 0x456 TCP_BBR_UNLIMITED = 0x43b TCP_BBR_USEDEL_RATE = 0x437 TCP_BBR_USE_LOWGAIN = 0x433 + TCP_BBR_USE_RACK_CHEAT = 0x450 + TCP_BBR_UTTER_MAX_TSO = 0x452 TCP_CA_NAME_MAX = 0x10 TCP_CCALGOOPT = 0x41 TCP_CONGESTION = 0x40 @@ -1541,6 +1634,7 @@ const ( TCP_PCAP_OUT = 0x800 TCP_RACK_EARLY_RECOV = 0x423 TCP_RACK_EARLY_SEG = 0x424 + TCP_RACK_GP_INCREASE = 0x446 TCP_RACK_IDLE_REDUCE_HIGH = 0x444 TCP_RACK_MIN_PACE = 0x445 TCP_RACK_MIN_PACE_SEG = 0x446 @@ -1554,7 +1648,6 @@ const ( TCP_RACK_PRR_SENDALOT = 0x421 TCP_RACK_REORD_FADE = 0x426 TCP_RACK_REORD_THRESH = 0x425 - TCP_RACK_SESS_CWV = 0x42a TCP_RACK_TLP_INC_VAR = 0x429 TCP_RACK_TLP_REDUCE = 0x41c TCP_RACK_TLP_THRESH = 0x427 @@ -1694,12 +1787,13 @@ const ( EIDRM = syscall.Errno(0x52) EILSEQ = syscall.Errno(0x56) EINPROGRESS = syscall.Errno(0x24) + EINTEGRITY = syscall.Errno(0x61) EINTR = syscall.Errno(0x4) EINVAL = syscall.Errno(0x16) EIO = syscall.Errno(0x5) EISCONN = syscall.Errno(0x38) EISDIR = syscall.Errno(0x15) - ELAST = syscall.Errno(0x60) + ELAST = syscall.Errno(0x61) ELOOP = syscall.Errno(0x3e) EMFILE = syscall.Errno(0x18) EMLINK = syscall.Errno(0x1f) @@ -1842,7 +1936,7 @@ var errorList = [...]struct { {32, "EPIPE", "broken pipe"}, {33, "EDOM", "numerical argument out of domain"}, {34, "ERANGE", "result too large"}, - {35, "EAGAIN", "resource temporarily unavailable"}, + {35, "EWOULDBLOCK", "resource temporarily unavailable"}, {36, "EINPROGRESS", "operation now in progress"}, {37, "EALREADY", "operation already in progress"}, {38, "ENOTSOCK", "socket operation on non-socket"}, @@ -1904,6 +1998,7 @@ var errorList = [...]struct { {94, "ECAPMODE", "not permitted in capability mode"}, {95, "ENOTRECOVERABLE", "state not recoverable"}, {96, "EOWNERDEAD", "previous owner died"}, + {97, "EINTEGRITY", "integrity check failed"}, } // Signal table diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go index 64520d31..96310c3b 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go @@ -151,6 +151,7 @@ const ( BIOCSETF = 0x80104267 BIOCSETFNR = 0x80104282 BIOCSETIF = 0x8020426c + BIOCSETVLANPCP = 0x80044285 BIOCSETWF = 0x8010427b BIOCSETZBUF = 0x80184281 BIOCSHDRCMPLT = 0x80044275 @@ -447,7 +448,7 @@ const ( DLT_IEEE802_16_MAC_CPS_RADIO = 0xc1 DLT_INFINIBAND = 0xf7 DLT_IPFILTER = 0x74 - DLT_IPMB = 0xc7 + DLT_IPMB_KONTRON = 0xc7 DLT_IPMB_LINUX = 0xd1 DLT_IPMI_HPM_2 = 0x104 DLT_IPNET = 0xe2 @@ -487,10 +488,11 @@ const ( DLT_LINUX_LAPD = 0xb1 DLT_LINUX_PPP_WITHDIRECTION = 0xa6 DLT_LINUX_SLL = 0x71 + DLT_LINUX_SLL2 = 0x114 DLT_LOOP = 0x6c DLT_LORATAP = 0x10e DLT_LTALK = 0x72 - DLT_MATCHING_MAX = 0x113 + DLT_MATCHING_MAX = 0x114 DLT_MATCHING_MIN = 0x68 DLT_MFR = 0xb6 DLT_MOST = 0xd3 @@ -734,6 +736,7 @@ const ( IPPROTO_CMTP = 0x26 IPPROTO_CPHB = 0x49 IPPROTO_CPNX = 0x48 + IPPROTO_DCCP = 0x21 IPPROTO_DDP = 0x25 IPPROTO_DGP = 0x56 IPPROTO_DIVERT = 0x102 @@ -814,7 +817,6 @@ const ( IPPROTO_SCTP = 0x84 IPPROTO_SDRP = 0x2a IPPROTO_SEND = 0x103 - IPPROTO_SEP = 0x21 IPPROTO_SHIM6 = 0x8c IPPROTO_SKIP = 0x39 IPPROTO_SPACER = 0x7fff @@ -911,6 +913,7 @@ const ( IPV6_V6ONLY = 0x1b IPV6_VERSION = 0x60 IPV6_VERSION_MASK = 0xf0 + IPV6_VLAN_PCP = 0x4b IP_ADD_MEMBERSHIP = 0xc IP_ADD_SOURCE_MEMBERSHIP = 0x46 IP_BINDANY = 0x18 @@ -989,8 +992,12 @@ const ( IP_TOS = 0x3 IP_TTL = 0x4 IP_UNBLOCK_SOURCE = 0x49 + IP_VLAN_PCP = 0x4b ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IXANY = 0x800 IXOFF = 0x400 IXON = 0x200 @@ -1000,7 +1007,6 @@ const ( KERN_VERSION = 0x4 LOCAL_CONNWAIT = 0x4 LOCAL_CREDS = 0x2 - LOCAL_CREDS_PERSISTENT = 0x3 LOCAL_PEERCRED = 0x1 LOCAL_VENDOR = 0x80000000 LOCK_EX = 0x2 @@ -1180,6 +1186,8 @@ const ( O_NONBLOCK = 0x4 O_RDONLY = 0x0 O_RDWR = 0x2 + O_RESOLVE_BENEATH = 0x800000 + O_SEARCH = 0x40000 O_SHLOCK = 0x10 O_SYNC = 0x80 O_TRUNC = 0x400 @@ -1190,6 +1198,10 @@ const ( PARMRK = 0x8 PARODD = 0x2000 PENDIN = 0x20000000 + PIOD_READ_D = 0x1 + PIOD_READ_I = 0x3 + PIOD_WRITE_D = 0x2 + PIOD_WRITE_I = 0x4 PRIO_PGRP = 0x1 PRIO_PROCESS = 0x0 PRIO_USER = 0x2 @@ -1197,6 +1209,58 @@ const ( PROT_NONE = 0x0 PROT_READ = 0x1 PROT_WRITE = 0x2 + PTRACE_DEFAULT = 0x1 + PTRACE_EXEC = 0x1 + PTRACE_FORK = 0x8 + PTRACE_LWP = 0x10 + PTRACE_SCE = 0x2 + PTRACE_SCX = 0x4 + PTRACE_SYSCALL = 0x6 + PTRACE_VFORK = 0x20 + PT_ATTACH = 0xa + PT_CLEARSTEP = 0x10 + PT_CONTINUE = 0x7 + PT_DETACH = 0xb + PT_FIRSTMACH = 0x40 + PT_FOLLOW_FORK = 0x17 + PT_GETDBREGS = 0x25 + PT_GETFPREGS = 0x23 + PT_GETFSBASE = 0x47 + PT_GETGSBASE = 0x49 + PT_GETLWPLIST = 0xf + PT_GETNUMLWPS = 0xe + PT_GETREGS = 0x21 + PT_GETXSTATE = 0x45 + PT_GETXSTATE_INFO = 0x44 + PT_GET_EVENT_MASK = 0x19 + PT_GET_SC_ARGS = 0x1b + PT_GET_SC_RET = 0x1c + PT_IO = 0xc + PT_KILL = 0x8 + PT_LWPINFO = 0xd + PT_LWP_EVENTS = 0x18 + PT_READ_D = 0x2 + PT_READ_I = 0x1 + PT_RESUME = 0x13 + PT_SETDBREGS = 0x26 + PT_SETFPREGS = 0x24 + PT_SETFSBASE = 0x48 + PT_SETGSBASE = 0x4a + PT_SETREGS = 0x22 + PT_SETSTEP = 0x11 + PT_SETXSTATE = 0x46 + PT_SET_EVENT_MASK = 0x1a + PT_STEP = 0x9 + PT_SUSPEND = 0x12 + PT_SYSCALL = 0x16 + PT_TO_SCE = 0x14 + PT_TO_SCX = 0x15 + PT_TRACE_ME = 0x0 + PT_VM_ENTRY = 0x29 + PT_VM_TIMESTAMP = 0x28 + PT_WRITE_D = 0x5 + PT_WRITE_I = 0x4 + P_ZONEID = 0xc RLIMIT_AS = 0xa RLIMIT_CORE = 0x4 RLIMIT_CPU = 0x0 @@ -1321,10 +1385,12 @@ const ( SIOCGHWADDR = 0xc020693e SIOCGI2C = 0xc020693d SIOCGIFADDR = 0xc0206921 + SIOCGIFALIAS = 0xc044692d SIOCGIFBRDADDR = 0xc0206923 SIOCGIFCAP = 0xc020691f SIOCGIFCONF = 0xc0106924 SIOCGIFDESCR = 0xc020692a + SIOCGIFDOWNREASON = 0xc058699a SIOCGIFDSTADDR = 0xc0206922 SIOCGIFFIB = 0xc020695c SIOCGIFFLAGS = 0xc0206911 @@ -1415,6 +1481,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 + SO_RERROR = 0x20000 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_REUSEPORT_LB = 0x10000 @@ -1473,22 +1540,40 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_FAST_OPEN = 0x22 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_PAD = 0x0 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_WINDOW = 0x3 TCP_BBR_ACK_COMP_ALG = 0x448 + TCP_BBR_ALGORITHM = 0x43b TCP_BBR_DRAIN_INC_EXTRA = 0x43c TCP_BBR_DRAIN_PG = 0x42e TCP_BBR_EXTRA_GAIN = 0x449 + TCP_BBR_EXTRA_STATE = 0x453 + TCP_BBR_FLOOR_MIN_TSO = 0x454 + TCP_BBR_HDWR_PACE = 0x451 + TCP_BBR_HOLD_TARGET = 0x436 TCP_BBR_IWINTSO = 0x42b TCP_BBR_LOWGAIN_FD = 0x436 TCP_BBR_LOWGAIN_HALF = 0x435 TCP_BBR_LOWGAIN_THRESH = 0x434 TCP_BBR_MAX_RTO = 0x439 TCP_BBR_MIN_RTO = 0x438 + TCP_BBR_MIN_TOPACEOUT = 0x455 TCP_BBR_ONE_RETRAN = 0x431 TCP_BBR_PACE_CROSS = 0x442 TCP_BBR_PACE_DEL_TAR = 0x43f + TCP_BBR_PACE_OH = 0x435 TCP_BBR_PACE_PER_SEC = 0x43e TCP_BBR_PACE_SEG_MAX = 0x440 TCP_BBR_PACE_SEG_MIN = 0x441 + TCP_BBR_POLICER_DETECT = 0x457 TCP_BBR_PROBE_RTT_GAIN = 0x44d TCP_BBR_PROBE_RTT_INT = 0x430 TCP_BBR_PROBE_RTT_LEN = 0x44e @@ -1497,12 +1582,18 @@ const ( TCP_BBR_REC_OVER_HPTS = 0x43a TCP_BBR_RETRAN_WTSO = 0x44b TCP_BBR_RWND_IS_APP = 0x42f + TCP_BBR_SEND_IWND_IN_TSO = 0x44f TCP_BBR_STARTUP_EXIT_EPOCH = 0x43d TCP_BBR_STARTUP_LOSS_EXIT = 0x432 TCP_BBR_STARTUP_PG = 0x42d + TCP_BBR_TMR_PACE_OH = 0x448 + TCP_BBR_TSLIMITS = 0x434 + TCP_BBR_TSTMP_RAISES = 0x456 TCP_BBR_UNLIMITED = 0x43b TCP_BBR_USEDEL_RATE = 0x437 TCP_BBR_USE_LOWGAIN = 0x433 + TCP_BBR_USE_RACK_CHEAT = 0x450 + TCP_BBR_UTTER_MAX_TSO = 0x452 TCP_CA_NAME_MAX = 0x10 TCP_CCALGOOPT = 0x41 TCP_CONGESTION = 0x40 @@ -1542,6 +1633,7 @@ const ( TCP_PCAP_OUT = 0x800 TCP_RACK_EARLY_RECOV = 0x423 TCP_RACK_EARLY_SEG = 0x424 + TCP_RACK_GP_INCREASE = 0x446 TCP_RACK_IDLE_REDUCE_HIGH = 0x444 TCP_RACK_MIN_PACE = 0x445 TCP_RACK_MIN_PACE_SEG = 0x446 @@ -1555,7 +1647,6 @@ const ( TCP_RACK_PRR_SENDALOT = 0x421 TCP_RACK_REORD_FADE = 0x426 TCP_RACK_REORD_THRESH = 0x425 - TCP_RACK_SESS_CWV = 0x42a TCP_RACK_TLP_INC_VAR = 0x429 TCP_RACK_TLP_REDUCE = 0x41c TCP_RACK_TLP_THRESH = 0x427 @@ -1693,12 +1784,13 @@ const ( EIDRM = syscall.Errno(0x52) EILSEQ = syscall.Errno(0x56) EINPROGRESS = syscall.Errno(0x24) + EINTEGRITY = syscall.Errno(0x61) EINTR = syscall.Errno(0x4) EINVAL = syscall.Errno(0x16) EIO = syscall.Errno(0x5) EISCONN = syscall.Errno(0x38) EISDIR = syscall.Errno(0x15) - ELAST = syscall.Errno(0x60) + ELAST = syscall.Errno(0x61) ELOOP = syscall.Errno(0x3e) EMFILE = syscall.Errno(0x18) EMLINK = syscall.Errno(0x1f) @@ -1841,7 +1933,7 @@ var errorList = [...]struct { {32, "EPIPE", "broken pipe"}, {33, "EDOM", "numerical argument out of domain"}, {34, "ERANGE", "result too large"}, - {35, "EAGAIN", "resource temporarily unavailable"}, + {35, "EWOULDBLOCK", "resource temporarily unavailable"}, {36, "EINPROGRESS", "operation now in progress"}, {37, "EALREADY", "operation already in progress"}, {38, "ENOTSOCK", "socket operation on non-socket"}, @@ -1903,6 +1995,7 @@ var errorList = [...]struct { {94, "ECAPMODE", "not permitted in capability mode"}, {95, "ENOTRECOVERABLE", "state not recoverable"}, {96, "EOWNERDEAD", "previous owner died"}, + {97, "EINTEGRITY", "integrity check failed"}, } // Signal table diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go index 99e9a0e0..777b69de 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go @@ -151,6 +151,7 @@ const ( BIOCSETF = 0x80084267 BIOCSETFNR = 0x80084282 BIOCSETIF = 0x8020426c + BIOCSETVLANPCP = 0x80044285 BIOCSETWF = 0x8008427b BIOCSETZBUF = 0x800c4281 BIOCSHDRCMPLT = 0x80044275 @@ -362,7 +363,7 @@ const ( CTL_KERN = 0x1 CTL_MAXNAME = 0x18 CTL_NET = 0x4 - DIOCGATTR = 0xc144648e + DIOCGATTR = 0xc148648e DIOCGDELETE = 0x80106488 DIOCGFLUSH = 0x20006487 DIOCGFRONTSTUFF = 0x40086486 @@ -377,7 +378,7 @@ const ( DIOCGSTRIPESIZE = 0x4008648b DIOCSKERNELDUMP = 0x804c6490 DIOCSKERNELDUMP_FREEBSD11 = 0x80046485 - DIOCZONECMD = 0xc06c648f + DIOCZONECMD = 0xc078648f DLT_A429 = 0xb8 DLT_A653_ICM = 0xb9 DLT_AIRONET_HEADER = 0x78 @@ -407,7 +408,9 @@ const ( DLT_C_HDLC_WITH_DIR = 0xcd DLT_DBUS = 0xe7 DLT_DECT = 0xdd + DLT_DISPLAYPORT_AUX = 0x113 DLT_DOCSIS = 0x8f + DLT_DOCSIS31_XRA31 = 0x111 DLT_DVB_CI = 0xeb DLT_ECONET = 0x73 DLT_EN10MB = 0x1 @@ -417,6 +420,7 @@ const ( DLT_ERF = 0xc5 DLT_ERF_ETH = 0xaf DLT_ERF_POS = 0xb0 + DLT_ETHERNET_MPACKET = 0x112 DLT_FC_2 = 0xe0 DLT_FC_2_WITH_FRAME_DELIMS = 0xe1 DLT_FDDI = 0xa @@ -444,7 +448,7 @@ const ( DLT_IEEE802_16_MAC_CPS_RADIO = 0xc1 DLT_INFINIBAND = 0xf7 DLT_IPFILTER = 0x74 - DLT_IPMB = 0xc7 + DLT_IPMB_KONTRON = 0xc7 DLT_IPMB_LINUX = 0xd1 DLT_IPMI_HPM_2 = 0x104 DLT_IPNET = 0xe2 @@ -484,9 +488,11 @@ const ( DLT_LINUX_LAPD = 0xb1 DLT_LINUX_PPP_WITHDIRECTION = 0xa6 DLT_LINUX_SLL = 0x71 + DLT_LINUX_SLL2 = 0x114 DLT_LOOP = 0x6c + DLT_LORATAP = 0x10e DLT_LTALK = 0x72 - DLT_MATCHING_MAX = 0x109 + DLT_MATCHING_MAX = 0x114 DLT_MATCHING_MIN = 0x68 DLT_MFR = 0xb6 DLT_MOST = 0xd3 @@ -502,7 +508,9 @@ const ( DLT_NFC_LLCP = 0xf5 DLT_NFLOG = 0xef DLT_NG40 = 0xf4 + DLT_NORDIC_BLE = 0x110 DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b DLT_PCI_EXP = 0x7d DLT_PFLOG = 0x75 DLT_PFSYNC = 0x79 @@ -526,15 +534,18 @@ const ( DLT_RTAC_SERIAL = 0xfa DLT_SCCP = 0x8e DLT_SCTP = 0xf8 + DLT_SDLC = 0x10c DLT_SITA = 0xc4 DLT_SLIP = 0x8 DLT_SLIP_BSDOS = 0xd DLT_STANAG_5066_D_PDU = 0xed DLT_SUNATM = 0x7b DLT_SYMANTEC_FIREWALL = 0x63 + DLT_TI_LLN_SNIFFER = 0x10d DLT_TZSP = 0x80 DLT_USB = 0xba DLT_USBPCAP = 0xf9 + DLT_USB_DARWIN = 0x10a DLT_USB_FREEBSD = 0xba DLT_USB_LINUX = 0xbd DLT_USB_LINUX_MMAPPED = 0xdc @@ -554,6 +565,7 @@ const ( DLT_USER7 = 0x9a DLT_USER8 = 0x9b DLT_USER9 = 0x9c + DLT_VSOCK = 0x10f DLT_WATTSTOPPER_DLM = 0x107 DLT_WIHART = 0xdf DLT_WIRESHARK_UPPER_PDU = 0xfc @@ -578,6 +590,7 @@ const ( ECHONL = 0x10 ECHOPRT = 0x20 EVFILT_AIO = -0x3 + EVFILT_EMPTY = -0xd EVFILT_FS = -0x9 EVFILT_LIO = -0xa EVFILT_PROC = -0x5 @@ -585,11 +598,12 @@ const ( EVFILT_READ = -0x1 EVFILT_SENDFILE = -0xc EVFILT_SIGNAL = -0x6 - EVFILT_SYSCOUNT = 0xc + EVFILT_SYSCOUNT = 0xd EVFILT_TIMER = -0x7 EVFILT_USER = -0xb EVFILT_VNODE = -0x4 EVFILT_WRITE = -0x2 + EVNAMEMAP_NAME_SIZE = 0x40 EV_ADD = 0x1 EV_CLEAR = 0x20 EV_DELETE = 0x2 @@ -606,6 +620,7 @@ const ( EV_RECEIPT = 0x40 EV_SYSFLAGS = 0xf000 EXTA = 0x4b00 + EXTATTR_MAXNAMELEN = 0xff EXTATTR_NAMESPACE_EMPTY = 0x0 EXTATTR_NAMESPACE_SYSTEM = 0x2 EXTATTR_NAMESPACE_USER = 0x1 @@ -647,6 +662,7 @@ const ( IEXTEN = 0x400 IFAN_ARRIVAL = 0x0 IFAN_DEPARTURE = 0x1 + IFCAP_WOL_MAGIC = 0x2000 IFF_ALLMULTI = 0x200 IFF_ALTPHYS = 0x4000 IFF_BROADCAST = 0x2 @@ -663,6 +679,7 @@ const ( IFF_MONITOR = 0x40000 IFF_MULTICAST = 0x8000 IFF_NOARP = 0x80 + IFF_NOGROUP = 0x800000 IFF_OACTIVE = 0x400 IFF_POINTOPOINT = 0x10 IFF_PPROMISC = 0x20000 @@ -719,6 +736,7 @@ const ( IPPROTO_CMTP = 0x26 IPPROTO_CPHB = 0x49 IPPROTO_CPNX = 0x48 + IPPROTO_DCCP = 0x21 IPPROTO_DDP = 0x25 IPPROTO_DGP = 0x56 IPPROTO_DIVERT = 0x102 @@ -799,7 +817,6 @@ const ( IPPROTO_SCTP = 0x84 IPPROTO_SDRP = 0x2a IPPROTO_SEND = 0x103 - IPPROTO_SEP = 0x21 IPPROTO_SHIM6 = 0x8c IPPROTO_SKIP = 0x39 IPPROTO_SPACER = 0x7fff @@ -837,6 +854,7 @@ const ( IPV6_DSTOPTS = 0x32 IPV6_FLOWID = 0x43 IPV6_FLOWINFO_MASK = 0xffffff0f + IPV6_FLOWLABEL_LEN = 0x14 IPV6_FLOWLABEL_MASK = 0xffff0f00 IPV6_FLOWTYPE = 0x44 IPV6_FRAGTTL = 0x78 @@ -857,13 +875,13 @@ const ( IPV6_MAX_GROUP_SRC_FILTER = 0x200 IPV6_MAX_MEMBERSHIPS = 0xfff IPV6_MAX_SOCK_SRC_FILTER = 0x80 - IPV6_MIN_MEMBERSHIPS = 0x1f IPV6_MMTU = 0x500 IPV6_MSFILTER = 0x4a IPV6_MULTICAST_HOPS = 0xa IPV6_MULTICAST_IF = 0x9 IPV6_MULTICAST_LOOP = 0xb IPV6_NEXTHOP = 0x30 + IPV6_ORIGDSTADDR = 0x48 IPV6_PATHMTU = 0x2c IPV6_PKTINFO = 0x2e IPV6_PORTRANGE = 0xe @@ -875,6 +893,7 @@ const ( IPV6_RECVFLOWID = 0x46 IPV6_RECVHOPLIMIT = 0x25 IPV6_RECVHOPOPTS = 0x27 + IPV6_RECVORIGDSTADDR = 0x48 IPV6_RECVPATHMTU = 0x2b IPV6_RECVPKTINFO = 0x24 IPV6_RECVRSSBUCKETID = 0x47 @@ -894,6 +913,7 @@ const ( IPV6_V6ONLY = 0x1b IPV6_VERSION = 0x60 IPV6_VERSION_MASK = 0xf0 + IPV6_VLAN_PCP = 0x4b IP_ADD_MEMBERSHIP = 0xc IP_ADD_SOURCE_MEMBERSHIP = 0x46 IP_BINDANY = 0x18 @@ -935,10 +955,8 @@ const ( IP_MAX_MEMBERSHIPS = 0xfff IP_MAX_SOCK_MUTE_FILTER = 0x80 IP_MAX_SOCK_SRC_FILTER = 0x80 - IP_MAX_SOURCE_FILTER = 0x400 IP_MF = 0x2000 IP_MINTTL = 0x42 - IP_MIN_MEMBERSHIPS = 0x1f IP_MSFILTER = 0x4a IP_MSS = 0x240 IP_MULTICAST_IF = 0x9 @@ -948,6 +966,7 @@ const ( IP_OFFMASK = 0x1fff IP_ONESBCAST = 0x17 IP_OPTIONS = 0x1 + IP_ORIGDSTADDR = 0x1b IP_PORTRANGE = 0x13 IP_PORTRANGE_DEFAULT = 0x0 IP_PORTRANGE_HIGH = 0x1 @@ -956,6 +975,7 @@ const ( IP_RECVFLOWID = 0x5d IP_RECVIF = 0x14 IP_RECVOPTS = 0x5 + IP_RECVORIGDSTADDR = 0x1b IP_RECVRETOPTS = 0x6 IP_RECVRSSBUCKETID = 0x5e IP_RECVTOS = 0x44 @@ -972,8 +992,12 @@ const ( IP_TOS = 0x3 IP_TTL = 0x4 IP_UNBLOCK_SOURCE = 0x49 + IP_VLAN_PCP = 0x4b ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IXANY = 0x800 IXOFF = 0x400 IXON = 0x200 @@ -983,7 +1007,6 @@ const ( KERN_VERSION = 0x4 LOCAL_CONNWAIT = 0x4 LOCAL_CREDS = 0x2 - LOCAL_CREDS_PERSISTENT = 0x3 LOCAL_PEERCRED = 0x1 LOCAL_VENDOR = 0x80000000 LOCK_EX = 0x2 @@ -1071,10 +1094,12 @@ const ( MNT_SUSPEND = 0x4 MNT_SYNCHRONOUS = 0x2 MNT_UNION = 0x20 + MNT_UNTRUSTED = 0x800000000 MNT_UPDATE = 0x10000 - MNT_UPDATEMASK = 0x2d8d0807e + MNT_UPDATEMASK = 0xad8d0807e MNT_USER = 0x8000 - MNT_VISFLAGMASK = 0x3fef0ffff + MNT_VERIFIED = 0x400000000 + MNT_VISFLAGMASK = 0xffef0ffff MNT_WAIT = 0x1 MSG_CMSG_CLOEXEC = 0x40000 MSG_COMPAT = 0x8000 @@ -1103,6 +1128,7 @@ const ( NFDBITS = 0x20 NOFLSH = 0x80000000 NOKERNINFO = 0x2000000 + NOTE_ABSTIME = 0x10 NOTE_ATTRIB = 0x8 NOTE_CHILD = 0x4 NOTE_CLOSE = 0x100 @@ -1159,6 +1185,8 @@ const ( O_NONBLOCK = 0x4 O_RDONLY = 0x0 O_RDWR = 0x2 + O_RESOLVE_BENEATH = 0x800000 + O_SEARCH = 0x40000 O_SHLOCK = 0x10 O_SYNC = 0x80 O_TRUNC = 0x400 @@ -1169,6 +1197,10 @@ const ( PARMRK = 0x8 PARODD = 0x2000 PENDIN = 0x20000000 + PIOD_READ_D = 0x1 + PIOD_READ_I = 0x3 + PIOD_WRITE_D = 0x2 + PIOD_WRITE_I = 0x4 PRIO_PGRP = 0x1 PRIO_PROCESS = 0x0 PRIO_USER = 0x2 @@ -1176,6 +1208,53 @@ const ( PROT_NONE = 0x0 PROT_READ = 0x1 PROT_WRITE = 0x2 + PTRACE_DEFAULT = 0x1 + PTRACE_EXEC = 0x1 + PTRACE_FORK = 0x8 + PTRACE_LWP = 0x10 + PTRACE_SCE = 0x2 + PTRACE_SCX = 0x4 + PTRACE_SYSCALL = 0x6 + PTRACE_VFORK = 0x20 + PT_ATTACH = 0xa + PT_CLEARSTEP = 0x10 + PT_CONTINUE = 0x7 + PT_DETACH = 0xb + PT_FIRSTMACH = 0x40 + PT_FOLLOW_FORK = 0x17 + PT_GETDBREGS = 0x25 + PT_GETFPREGS = 0x23 + PT_GETLWPLIST = 0xf + PT_GETNUMLWPS = 0xe + PT_GETREGS = 0x21 + PT_GETVFPREGS = 0x40 + PT_GET_EVENT_MASK = 0x19 + PT_GET_SC_ARGS = 0x1b + PT_GET_SC_RET = 0x1c + PT_IO = 0xc + PT_KILL = 0x8 + PT_LWPINFO = 0xd + PT_LWP_EVENTS = 0x18 + PT_READ_D = 0x2 + PT_READ_I = 0x1 + PT_RESUME = 0x13 + PT_SETDBREGS = 0x26 + PT_SETFPREGS = 0x24 + PT_SETREGS = 0x22 + PT_SETSTEP = 0x11 + PT_SETVFPREGS = 0x41 + PT_SET_EVENT_MASK = 0x1a + PT_STEP = 0x9 + PT_SUSPEND = 0x12 + PT_SYSCALL = 0x16 + PT_TO_SCE = 0x14 + PT_TO_SCX = 0x15 + PT_TRACE_ME = 0x0 + PT_VM_ENTRY = 0x29 + PT_VM_TIMESTAMP = 0x28 + PT_WRITE_D = 0x5 + PT_WRITE_I = 0x4 + P_ZONEID = 0xc RLIMIT_AS = 0xa RLIMIT_CORE = 0x4 RLIMIT_CPU = 0x0 @@ -1257,7 +1336,6 @@ const ( RTV_WEIGHT = 0x100 RT_ALL_FIBS = -0x1 RT_BLACKHOLE = 0x40 - RT_CACHING_CONTEXT = 0x1 RT_DEFAULT_FIB = 0x0 RT_HAS_GW = 0x80 RT_HAS_HEADER = 0x10 @@ -1267,15 +1345,17 @@ const ( RT_LLE_CACHE = 0x100 RT_MAY_LOOP = 0x8 RT_MAY_LOOP_BIT = 0x3 - RT_NORTREF = 0x2 RT_REJECT = 0x20 RUSAGE_CHILDREN = -0x1 RUSAGE_SELF = 0x0 RUSAGE_THREAD = 0x1 SCM_BINTIME = 0x4 SCM_CREDS = 0x3 + SCM_MONOTONIC = 0x6 + SCM_REALTIME = 0x5 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x2 + SCM_TIME_INFO = 0x7 SEEK_CUR = 0x1 SEEK_DATA = 0x3 SEEK_END = 0x2 @@ -1299,10 +1379,12 @@ const ( SIOCGHWADDR = 0xc020693e SIOCGI2C = 0xc020693d SIOCGIFADDR = 0xc0206921 + SIOCGIFALIAS = 0xc044692d SIOCGIFBRDADDR = 0xc0206923 SIOCGIFCAP = 0xc020691f SIOCGIFCONF = 0xc0086924 SIOCGIFDESCR = 0xc020692a + SIOCGIFDOWNREASON = 0xc058699a SIOCGIFDSTADDR = 0xc0206922 SIOCGIFFIB = 0xc020695c SIOCGIFFLAGS = 0xc0206911 @@ -1318,8 +1400,11 @@ const ( SIOCGIFPDSTADDR = 0xc0206948 SIOCGIFPHYS = 0xc0206935 SIOCGIFPSRCADDR = 0xc0206947 + SIOCGIFRSSHASH = 0xc0186997 + SIOCGIFRSSKEY = 0xc0946996 SIOCGIFSTATUS = 0xc331693b SIOCGIFXMEDIA = 0xc028698b + SIOCGLANPCP = 0xc0206998 SIOCGLOWAT = 0x40047303 SIOCGPGRP = 0x40047309 SIOCGPRIVATE_0 = 0xc0206950 @@ -1350,6 +1435,7 @@ const ( SIOCSIFPHYS = 0x80206936 SIOCSIFRVNET = 0xc020695b SIOCSIFVNET = 0xc020695a + SIOCSLANPCP = 0x80206999 SIOCSLOWAT = 0x80047302 SIOCSPGRP = 0x80047308 SIOCSTUNFIB = 0x8020695f @@ -1369,6 +1455,7 @@ const ( SO_BINTIME = 0x2000 SO_BROADCAST = 0x20 SO_DEBUG = 0x1 + SO_DOMAIN = 0x1019 SO_DONTROUTE = 0x10 SO_ERROR = 0x1007 SO_KEEPALIVE = 0x8 @@ -1377,6 +1464,7 @@ const ( SO_LISTENINCQLEN = 0x1013 SO_LISTENQLEN = 0x1012 SO_LISTENQLIMIT = 0x1011 + SO_MAX_PACING_RATE = 0x1018 SO_NOSIGPIPE = 0x800 SO_NO_DDP = 0x8000 SO_NO_OFFLOAD = 0x4000 @@ -1387,13 +1475,22 @@ const ( SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 + SO_RERROR = 0x20000 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 + SO_REUSEPORT_LB = 0x10000 SO_SETFIB = 0x1014 SO_SNDBUF = 0x1001 SO_SNDLOWAT = 0x1003 SO_SNDTIMEO = 0x1005 SO_TIMESTAMP = 0x400 + SO_TS_BINTIME = 0x1 + SO_TS_CLOCK = 0x1017 + SO_TS_CLOCK_MAX = 0x3 + SO_TS_DEFAULT = 0x0 + SO_TS_MONOTONIC = 0x3 + SO_TS_REALTIME = 0x2 + SO_TS_REALTIME_MICRO = 0x0 SO_TYPE = 0x1008 SO_USELOOPBACK = 0x40 SO_USER_COOKIE = 0x1015 @@ -1437,10 +1534,69 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_FAST_OPEN = 0x22 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_PAD = 0x0 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_WINDOW = 0x3 + TCP_BBR_ACK_COMP_ALG = 0x448 + TCP_BBR_ALGORITHM = 0x43b + TCP_BBR_DRAIN_INC_EXTRA = 0x43c + TCP_BBR_DRAIN_PG = 0x42e + TCP_BBR_EXTRA_GAIN = 0x449 + TCP_BBR_EXTRA_STATE = 0x453 + TCP_BBR_FLOOR_MIN_TSO = 0x454 + TCP_BBR_HDWR_PACE = 0x451 + TCP_BBR_HOLD_TARGET = 0x436 + TCP_BBR_IWINTSO = 0x42b + TCP_BBR_LOWGAIN_FD = 0x436 + TCP_BBR_LOWGAIN_HALF = 0x435 + TCP_BBR_LOWGAIN_THRESH = 0x434 + TCP_BBR_MAX_RTO = 0x439 + TCP_BBR_MIN_RTO = 0x438 + TCP_BBR_MIN_TOPACEOUT = 0x455 + TCP_BBR_ONE_RETRAN = 0x431 + TCP_BBR_PACE_CROSS = 0x442 + TCP_BBR_PACE_DEL_TAR = 0x43f + TCP_BBR_PACE_OH = 0x435 + TCP_BBR_PACE_PER_SEC = 0x43e + TCP_BBR_PACE_SEG_MAX = 0x440 + TCP_BBR_PACE_SEG_MIN = 0x441 + TCP_BBR_POLICER_DETECT = 0x457 + TCP_BBR_PROBE_RTT_GAIN = 0x44d + TCP_BBR_PROBE_RTT_INT = 0x430 + TCP_BBR_PROBE_RTT_LEN = 0x44e + TCP_BBR_RACK_RTT_USE = 0x44a + TCP_BBR_RECFORCE = 0x42c + TCP_BBR_REC_OVER_HPTS = 0x43a + TCP_BBR_RETRAN_WTSO = 0x44b + TCP_BBR_RWND_IS_APP = 0x42f + TCP_BBR_SEND_IWND_IN_TSO = 0x44f + TCP_BBR_STARTUP_EXIT_EPOCH = 0x43d + TCP_BBR_STARTUP_LOSS_EXIT = 0x432 + TCP_BBR_STARTUP_PG = 0x42d + TCP_BBR_TMR_PACE_OH = 0x448 + TCP_BBR_TSLIMITS = 0x434 + TCP_BBR_TSTMP_RAISES = 0x456 + TCP_BBR_UNLIMITED = 0x43b + TCP_BBR_USEDEL_RATE = 0x437 + TCP_BBR_USE_LOWGAIN = 0x433 + TCP_BBR_USE_RACK_CHEAT = 0x450 + TCP_BBR_UTTER_MAX_TSO = 0x452 TCP_CA_NAME_MAX = 0x10 TCP_CCALGOOPT = 0x41 TCP_CONGESTION = 0x40 + TCP_DATA_AFTER_CLOSE = 0x44c + TCP_DELACK = 0x48 TCP_FASTOPEN = 0x401 + TCP_FASTOPEN_MAX_COOKIE_LEN = 0x10 + TCP_FASTOPEN_MIN_COOKIE_LEN = 0x4 + TCP_FASTOPEN_PSK_LEN = 0x10 TCP_FUNCTION_BLK = 0x2000 TCP_FUNCTION_NAME_LEN_MAX = 0x20 TCP_INFO = 0x20 @@ -1448,6 +1604,12 @@ const ( TCP_KEEPIDLE = 0x100 TCP_KEEPINIT = 0x80 TCP_KEEPINTVL = 0x200 + TCP_LOG = 0x22 + TCP_LOGBUF = 0x23 + TCP_LOGDUMP = 0x25 + TCP_LOGDUMPID = 0x26 + TCP_LOGID = 0x24 + TCP_LOG_ID_LEN = 0x40 TCP_MAXBURST = 0x4 TCP_MAXHLEN = 0x3c TCP_MAXOLEN = 0x28 @@ -1463,8 +1625,30 @@ const ( TCP_NOPUSH = 0x4 TCP_PCAP_IN = 0x1000 TCP_PCAP_OUT = 0x800 + TCP_RACK_EARLY_RECOV = 0x423 + TCP_RACK_EARLY_SEG = 0x424 + TCP_RACK_GP_INCREASE = 0x446 + TCP_RACK_IDLE_REDUCE_HIGH = 0x444 + TCP_RACK_MIN_PACE = 0x445 + TCP_RACK_MIN_PACE_SEG = 0x446 + TCP_RACK_MIN_TO = 0x422 + TCP_RACK_PACE_ALWAYS = 0x41f + TCP_RACK_PACE_MAX_SEG = 0x41e + TCP_RACK_PACE_REDUCE = 0x41d + TCP_RACK_PKT_DELAY = 0x428 + TCP_RACK_PROP = 0x41b + TCP_RACK_PROP_RATE = 0x420 + TCP_RACK_PRR_SENDALOT = 0x421 + TCP_RACK_REORD_FADE = 0x426 + TCP_RACK_REORD_THRESH = 0x425 + TCP_RACK_TLP_INC_VAR = 0x429 + TCP_RACK_TLP_REDUCE = 0x41c + TCP_RACK_TLP_THRESH = 0x427 + TCP_RACK_TLP_USE = 0x447 TCP_VENDOR = 0x80000000 TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 TIOCCBRK = 0x2000747a TIOCCDTR = 0x20007478 TIOCCONS = 0x80047462 @@ -1528,6 +1712,8 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UTIME_NOW = -0x1 + UTIME_OMIT = -0x2 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 @@ -1592,12 +1778,13 @@ const ( EIDRM = syscall.Errno(0x52) EILSEQ = syscall.Errno(0x56) EINPROGRESS = syscall.Errno(0x24) + EINTEGRITY = syscall.Errno(0x61) EINTR = syscall.Errno(0x4) EINVAL = syscall.Errno(0x16) EIO = syscall.Errno(0x5) EISCONN = syscall.Errno(0x38) EISDIR = syscall.Errno(0x15) - ELAST = syscall.Errno(0x60) + ELAST = syscall.Errno(0x61) ELOOP = syscall.Errno(0x3e) EMFILE = syscall.Errno(0x18) EMLINK = syscall.Errno(0x1f) @@ -1740,7 +1927,7 @@ var errorList = [...]struct { {32, "EPIPE", "broken pipe"}, {33, "EDOM", "numerical argument out of domain"}, {34, "ERANGE", "result too large"}, - {35, "EAGAIN", "resource temporarily unavailable"}, + {35, "EWOULDBLOCK", "resource temporarily unavailable"}, {36, "EINPROGRESS", "operation now in progress"}, {37, "EALREADY", "operation already in progress"}, {38, "ENOTSOCK", "socket operation on non-socket"}, @@ -1802,6 +1989,7 @@ var errorList = [...]struct { {94, "ECAPMODE", "not permitted in capability mode"}, {95, "ENOTRECOVERABLE", "state not recoverable"}, {96, "EOWNERDEAD", "previous owner died"}, + {97, "EINTEGRITY", "integrity check failed"}, } // Signal table diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go index 4c837711..c557ac2d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go @@ -151,6 +151,7 @@ const ( BIOCSETF = 0x80104267 BIOCSETFNR = 0x80104282 BIOCSETIF = 0x8020426c + BIOCSETVLANPCP = 0x80044285 BIOCSETWF = 0x8010427b BIOCSETZBUF = 0x80184281 BIOCSHDRCMPLT = 0x80044275 @@ -447,7 +448,7 @@ const ( DLT_IEEE802_16_MAC_CPS_RADIO = 0xc1 DLT_INFINIBAND = 0xf7 DLT_IPFILTER = 0x74 - DLT_IPMB = 0xc7 + DLT_IPMB_KONTRON = 0xc7 DLT_IPMB_LINUX = 0xd1 DLT_IPMI_HPM_2 = 0x104 DLT_IPNET = 0xe2 @@ -487,10 +488,11 @@ const ( DLT_LINUX_LAPD = 0xb1 DLT_LINUX_PPP_WITHDIRECTION = 0xa6 DLT_LINUX_SLL = 0x71 + DLT_LINUX_SLL2 = 0x114 DLT_LOOP = 0x6c DLT_LORATAP = 0x10e DLT_LTALK = 0x72 - DLT_MATCHING_MAX = 0x113 + DLT_MATCHING_MAX = 0x114 DLT_MATCHING_MIN = 0x68 DLT_MFR = 0xb6 DLT_MOST = 0xd3 @@ -734,6 +736,7 @@ const ( IPPROTO_CMTP = 0x26 IPPROTO_CPHB = 0x49 IPPROTO_CPNX = 0x48 + IPPROTO_DCCP = 0x21 IPPROTO_DDP = 0x25 IPPROTO_DGP = 0x56 IPPROTO_DIVERT = 0x102 @@ -814,7 +817,6 @@ const ( IPPROTO_SCTP = 0x84 IPPROTO_SDRP = 0x2a IPPROTO_SEND = 0x103 - IPPROTO_SEP = 0x21 IPPROTO_SHIM6 = 0x8c IPPROTO_SKIP = 0x39 IPPROTO_SPACER = 0x7fff @@ -911,6 +913,7 @@ const ( IPV6_V6ONLY = 0x1b IPV6_VERSION = 0x60 IPV6_VERSION_MASK = 0xf0 + IPV6_VLAN_PCP = 0x4b IP_ADD_MEMBERSHIP = 0xc IP_ADD_SOURCE_MEMBERSHIP = 0x46 IP_BINDANY = 0x18 @@ -989,8 +992,12 @@ const ( IP_TOS = 0x3 IP_TTL = 0x4 IP_UNBLOCK_SOURCE = 0x49 + IP_VLAN_PCP = 0x4b ISIG = 0x80 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IXANY = 0x800 IXOFF = 0x400 IXON = 0x200 @@ -1000,7 +1007,6 @@ const ( KERN_VERSION = 0x4 LOCAL_CONNWAIT = 0x4 LOCAL_CREDS = 0x2 - LOCAL_CREDS_PERSISTENT = 0x3 LOCAL_PEERCRED = 0x1 LOCAL_VENDOR = 0x80000000 LOCK_EX = 0x2 @@ -1180,6 +1186,8 @@ const ( O_NONBLOCK = 0x4 O_RDONLY = 0x0 O_RDWR = 0x2 + O_RESOLVE_BENEATH = 0x800000 + O_SEARCH = 0x40000 O_SHLOCK = 0x10 O_SYNC = 0x80 O_TRUNC = 0x400 @@ -1190,6 +1198,10 @@ const ( PARMRK = 0x8 PARODD = 0x2000 PENDIN = 0x20000000 + PIOD_READ_D = 0x1 + PIOD_READ_I = 0x3 + PIOD_WRITE_D = 0x2 + PIOD_WRITE_I = 0x4 PRIO_PGRP = 0x1 PRIO_PROCESS = 0x0 PRIO_USER = 0x2 @@ -1197,6 +1209,51 @@ const ( PROT_NONE = 0x0 PROT_READ = 0x1 PROT_WRITE = 0x2 + PTRACE_DEFAULT = 0x1 + PTRACE_EXEC = 0x1 + PTRACE_FORK = 0x8 + PTRACE_LWP = 0x10 + PTRACE_SCE = 0x2 + PTRACE_SCX = 0x4 + PTRACE_SYSCALL = 0x6 + PTRACE_VFORK = 0x20 + PT_ATTACH = 0xa + PT_CLEARSTEP = 0x10 + PT_CONTINUE = 0x7 + PT_DETACH = 0xb + PT_FIRSTMACH = 0x40 + PT_FOLLOW_FORK = 0x17 + PT_GETDBREGS = 0x25 + PT_GETFPREGS = 0x23 + PT_GETLWPLIST = 0xf + PT_GETNUMLWPS = 0xe + PT_GETREGS = 0x21 + PT_GET_EVENT_MASK = 0x19 + PT_GET_SC_ARGS = 0x1b + PT_GET_SC_RET = 0x1c + PT_IO = 0xc + PT_KILL = 0x8 + PT_LWPINFO = 0xd + PT_LWP_EVENTS = 0x18 + PT_READ_D = 0x2 + PT_READ_I = 0x1 + PT_RESUME = 0x13 + PT_SETDBREGS = 0x26 + PT_SETFPREGS = 0x24 + PT_SETREGS = 0x22 + PT_SETSTEP = 0x11 + PT_SET_EVENT_MASK = 0x1a + PT_STEP = 0x9 + PT_SUSPEND = 0x12 + PT_SYSCALL = 0x16 + PT_TO_SCE = 0x14 + PT_TO_SCX = 0x15 + PT_TRACE_ME = 0x0 + PT_VM_ENTRY = 0x29 + PT_VM_TIMESTAMP = 0x28 + PT_WRITE_D = 0x5 + PT_WRITE_I = 0x4 + P_ZONEID = 0xc RLIMIT_AS = 0xa RLIMIT_CORE = 0x4 RLIMIT_CPU = 0x0 @@ -1321,10 +1378,12 @@ const ( SIOCGHWADDR = 0xc020693e SIOCGI2C = 0xc020693d SIOCGIFADDR = 0xc0206921 + SIOCGIFALIAS = 0xc044692d SIOCGIFBRDADDR = 0xc0206923 SIOCGIFCAP = 0xc020691f SIOCGIFCONF = 0xc0106924 SIOCGIFDESCR = 0xc020692a + SIOCGIFDOWNREASON = 0xc058699a SIOCGIFDSTADDR = 0xc0206922 SIOCGIFFIB = 0xc020695c SIOCGIFFLAGS = 0xc0206911 @@ -1415,6 +1474,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVLOWAT = 0x1004 SO_RCVTIMEO = 0x1006 + SO_RERROR = 0x20000 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_REUSEPORT_LB = 0x10000 @@ -1473,22 +1533,40 @@ const ( TCOFLUSH = 0x2 TCOOFF = 0x1 TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_FAST_OPEN = 0x22 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_PAD = 0x0 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_WINDOW = 0x3 TCP_BBR_ACK_COMP_ALG = 0x448 + TCP_BBR_ALGORITHM = 0x43b TCP_BBR_DRAIN_INC_EXTRA = 0x43c TCP_BBR_DRAIN_PG = 0x42e TCP_BBR_EXTRA_GAIN = 0x449 + TCP_BBR_EXTRA_STATE = 0x453 + TCP_BBR_FLOOR_MIN_TSO = 0x454 + TCP_BBR_HDWR_PACE = 0x451 + TCP_BBR_HOLD_TARGET = 0x436 TCP_BBR_IWINTSO = 0x42b TCP_BBR_LOWGAIN_FD = 0x436 TCP_BBR_LOWGAIN_HALF = 0x435 TCP_BBR_LOWGAIN_THRESH = 0x434 TCP_BBR_MAX_RTO = 0x439 TCP_BBR_MIN_RTO = 0x438 + TCP_BBR_MIN_TOPACEOUT = 0x455 TCP_BBR_ONE_RETRAN = 0x431 TCP_BBR_PACE_CROSS = 0x442 TCP_BBR_PACE_DEL_TAR = 0x43f + TCP_BBR_PACE_OH = 0x435 TCP_BBR_PACE_PER_SEC = 0x43e TCP_BBR_PACE_SEG_MAX = 0x440 TCP_BBR_PACE_SEG_MIN = 0x441 + TCP_BBR_POLICER_DETECT = 0x457 TCP_BBR_PROBE_RTT_GAIN = 0x44d TCP_BBR_PROBE_RTT_INT = 0x430 TCP_BBR_PROBE_RTT_LEN = 0x44e @@ -1497,12 +1575,18 @@ const ( TCP_BBR_REC_OVER_HPTS = 0x43a TCP_BBR_RETRAN_WTSO = 0x44b TCP_BBR_RWND_IS_APP = 0x42f + TCP_BBR_SEND_IWND_IN_TSO = 0x44f TCP_BBR_STARTUP_EXIT_EPOCH = 0x43d TCP_BBR_STARTUP_LOSS_EXIT = 0x432 TCP_BBR_STARTUP_PG = 0x42d + TCP_BBR_TMR_PACE_OH = 0x448 + TCP_BBR_TSLIMITS = 0x434 + TCP_BBR_TSTMP_RAISES = 0x456 TCP_BBR_UNLIMITED = 0x43b TCP_BBR_USEDEL_RATE = 0x437 TCP_BBR_USE_LOWGAIN = 0x433 + TCP_BBR_USE_RACK_CHEAT = 0x450 + TCP_BBR_UTTER_MAX_TSO = 0x452 TCP_CA_NAME_MAX = 0x10 TCP_CCALGOOPT = 0x41 TCP_CONGESTION = 0x40 @@ -1542,6 +1626,7 @@ const ( TCP_PCAP_OUT = 0x800 TCP_RACK_EARLY_RECOV = 0x423 TCP_RACK_EARLY_SEG = 0x424 + TCP_RACK_GP_INCREASE = 0x446 TCP_RACK_IDLE_REDUCE_HIGH = 0x444 TCP_RACK_MIN_PACE = 0x445 TCP_RACK_MIN_PACE_SEG = 0x446 @@ -1555,7 +1640,6 @@ const ( TCP_RACK_PRR_SENDALOT = 0x421 TCP_RACK_REORD_FADE = 0x426 TCP_RACK_REORD_THRESH = 0x425 - TCP_RACK_SESS_CWV = 0x42a TCP_RACK_TLP_INC_VAR = 0x429 TCP_RACK_TLP_REDUCE = 0x41c TCP_RACK_TLP_THRESH = 0x427 @@ -1694,12 +1778,13 @@ const ( EIDRM = syscall.Errno(0x52) EILSEQ = syscall.Errno(0x56) EINPROGRESS = syscall.Errno(0x24) + EINTEGRITY = syscall.Errno(0x61) EINTR = syscall.Errno(0x4) EINVAL = syscall.Errno(0x16) EIO = syscall.Errno(0x5) EISCONN = syscall.Errno(0x38) EISDIR = syscall.Errno(0x15) - ELAST = syscall.Errno(0x60) + ELAST = syscall.Errno(0x61) ELOOP = syscall.Errno(0x3e) EMFILE = syscall.Errno(0x18) EMLINK = syscall.Errno(0x1f) @@ -1842,7 +1927,7 @@ var errorList = [...]struct { {32, "EPIPE", "broken pipe"}, {33, "EDOM", "numerical argument out of domain"}, {34, "ERANGE", "result too large"}, - {35, "EAGAIN", "resource temporarily unavailable"}, + {35, "EWOULDBLOCK", "resource temporarily unavailable"}, {36, "EINPROGRESS", "operation now in progress"}, {37, "EALREADY", "operation already in progress"}, {38, "ENOTSOCK", "socket operation on non-socket"}, @@ -1904,6 +1989,7 @@ var errorList = [...]struct { {94, "ECAPMODE", "not permitted in capability mode"}, {95, "ENOTRECOVERABLE", "state not recoverable"}, {96, "EOWNERDEAD", "previous owner died"}, + {97, "EINTEGRITY", "integrity check failed"}, } // Signal table diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go new file mode 100644 index 00000000..341b4d96 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go @@ -0,0 +1,2148 @@ +// mkerrors.sh -m64 +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && freebsd +// +build riscv64,freebsd + +// Code generated by cmd/cgo -godefs; DO NOT EDIT. +// cgo -godefs -- -m64 _const.go + +package unix + +import "syscall" + +const ( + AF_APPLETALK = 0x10 + AF_ARP = 0x23 + AF_ATM = 0x1e + AF_BLUETOOTH = 0x24 + AF_CCITT = 0xa + AF_CHAOS = 0x5 + AF_CNT = 0x15 + AF_COIP = 0x14 + AF_DATAKIT = 0x9 + AF_DECnet = 0xc + AF_DLI = 0xd + AF_E164 = 0x1a + AF_ECMA = 0x8 + AF_HYLINK = 0xf + AF_HYPERV = 0x2b + AF_IEEE80211 = 0x25 + AF_IMPLINK = 0x3 + AF_INET = 0x2 + AF_INET6 = 0x1c + AF_INET6_SDP = 0x2a + AF_INET_SDP = 0x28 + AF_IPX = 0x17 + AF_ISDN = 0x1a + AF_ISO = 0x7 + AF_LAT = 0xe + AF_LINK = 0x12 + AF_LOCAL = 0x1 + AF_MAX = 0x2b + AF_NATM = 0x1d + AF_NETBIOS = 0x6 + AF_NETGRAPH = 0x20 + AF_OSI = 0x7 + AF_PUP = 0x4 + AF_ROUTE = 0x11 + AF_SCLUSTER = 0x22 + AF_SIP = 0x18 + AF_SLOW = 0x21 + AF_SNA = 0xb + AF_UNIX = 0x1 + AF_UNSPEC = 0x0 + AF_VENDOR00 = 0x27 + AF_VENDOR01 = 0x29 + AF_VENDOR03 = 0x2d + AF_VENDOR04 = 0x2f + AF_VENDOR05 = 0x31 + AF_VENDOR06 = 0x33 + AF_VENDOR07 = 0x35 + AF_VENDOR08 = 0x37 + AF_VENDOR09 = 0x39 + AF_VENDOR10 = 0x3b + AF_VENDOR11 = 0x3d + AF_VENDOR12 = 0x3f + AF_VENDOR13 = 0x41 + AF_VENDOR14 = 0x43 + AF_VENDOR15 = 0x45 + AF_VENDOR16 = 0x47 + AF_VENDOR17 = 0x49 + AF_VENDOR18 = 0x4b + AF_VENDOR19 = 0x4d + AF_VENDOR20 = 0x4f + AF_VENDOR21 = 0x51 + AF_VENDOR22 = 0x53 + AF_VENDOR23 = 0x55 + AF_VENDOR24 = 0x57 + AF_VENDOR25 = 0x59 + AF_VENDOR26 = 0x5b + AF_VENDOR27 = 0x5d + AF_VENDOR28 = 0x5f + AF_VENDOR29 = 0x61 + AF_VENDOR30 = 0x63 + AF_VENDOR31 = 0x65 + AF_VENDOR32 = 0x67 + AF_VENDOR33 = 0x69 + AF_VENDOR34 = 0x6b + AF_VENDOR35 = 0x6d + AF_VENDOR36 = 0x6f + AF_VENDOR37 = 0x71 + AF_VENDOR38 = 0x73 + AF_VENDOR39 = 0x75 + AF_VENDOR40 = 0x77 + AF_VENDOR41 = 0x79 + AF_VENDOR42 = 0x7b + AF_VENDOR43 = 0x7d + AF_VENDOR44 = 0x7f + AF_VENDOR45 = 0x81 + AF_VENDOR46 = 0x83 + AF_VENDOR47 = 0x85 + ALTWERASE = 0x200 + B0 = 0x0 + B1000000 = 0xf4240 + B110 = 0x6e + B115200 = 0x1c200 + B1200 = 0x4b0 + B134 = 0x86 + B14400 = 0x3840 + B150 = 0x96 + B1500000 = 0x16e360 + B1800 = 0x708 + B19200 = 0x4b00 + B200 = 0xc8 + B2000000 = 0x1e8480 + B230400 = 0x38400 + B2400 = 0x960 + B2500000 = 0x2625a0 + B28800 = 0x7080 + B300 = 0x12c + B3000000 = 0x2dc6c0 + B3500000 = 0x3567e0 + B38400 = 0x9600 + B4000000 = 0x3d0900 + B460800 = 0x70800 + B4800 = 0x12c0 + B50 = 0x32 + B500000 = 0x7a120 + B57600 = 0xe100 + B600 = 0x258 + B7200 = 0x1c20 + B75 = 0x4b + B76800 = 0x12c00 + B921600 = 0xe1000 + B9600 = 0x2580 + BIOCFEEDBACK = 0x8004427c + BIOCFLUSH = 0x20004268 + BIOCGBLEN = 0x40044266 + BIOCGDIRECTION = 0x40044276 + BIOCGDLT = 0x4004426a + BIOCGDLTLIST = 0xc0104279 + BIOCGETBUFMODE = 0x4004427d + BIOCGETIF = 0x4020426b + BIOCGETZMAX = 0x4008427f + BIOCGHDRCMPLT = 0x40044274 + BIOCGRSIG = 0x40044272 + BIOCGRTIMEOUT = 0x4010426e + BIOCGSEESENT = 0x40044276 + BIOCGSTATS = 0x4008426f + BIOCGTSTAMP = 0x40044283 + BIOCIMMEDIATE = 0x80044270 + BIOCLOCK = 0x2000427a + BIOCPROMISC = 0x20004269 + BIOCROTZBUF = 0x40184280 + BIOCSBLEN = 0xc0044266 + BIOCSDIRECTION = 0x80044277 + BIOCSDLT = 0x80044278 + BIOCSETBUFMODE = 0x8004427e + BIOCSETF = 0x80104267 + BIOCSETFNR = 0x80104282 + BIOCSETIF = 0x8020426c + BIOCSETVLANPCP = 0x80044285 + BIOCSETWF = 0x8010427b + BIOCSETZBUF = 0x80184281 + BIOCSHDRCMPLT = 0x80044275 + BIOCSRSIG = 0x80044273 + BIOCSRTIMEOUT = 0x8010426d + BIOCSSEESENT = 0x80044277 + BIOCSTSTAMP = 0x80044284 + BIOCVERSION = 0x40044271 + BPF_A = 0x10 + BPF_ABS = 0x20 + BPF_ADD = 0x0 + BPF_ALIGNMENT = 0x8 + BPF_ALU = 0x4 + BPF_AND = 0x50 + BPF_B = 0x10 + BPF_BUFMODE_BUFFER = 0x1 + BPF_BUFMODE_ZBUF = 0x2 + BPF_DIV = 0x30 + BPF_H = 0x8 + BPF_IMM = 0x0 + BPF_IND = 0x40 + BPF_JA = 0x0 + BPF_JEQ = 0x10 + BPF_JGE = 0x30 + BPF_JGT = 0x20 + BPF_JMP = 0x5 + BPF_JSET = 0x40 + BPF_K = 0x0 + BPF_LD = 0x0 + BPF_LDX = 0x1 + BPF_LEN = 0x80 + BPF_LSH = 0x60 + BPF_MAJOR_VERSION = 0x1 + BPF_MAXBUFSIZE = 0x80000 + BPF_MAXINSNS = 0x200 + BPF_MEM = 0x60 + BPF_MEMWORDS = 0x10 + BPF_MINBUFSIZE = 0x20 + BPF_MINOR_VERSION = 0x1 + BPF_MISC = 0x7 + BPF_MOD = 0x90 + BPF_MSH = 0xa0 + BPF_MUL = 0x20 + BPF_NEG = 0x80 + BPF_OR = 0x40 + BPF_RELEASE = 0x30bb6 + BPF_RET = 0x6 + BPF_RSH = 0x70 + BPF_ST = 0x2 + BPF_STX = 0x3 + BPF_SUB = 0x10 + BPF_TAX = 0x0 + BPF_TXA = 0x80 + BPF_T_BINTIME = 0x2 + BPF_T_BINTIME_FAST = 0x102 + BPF_T_BINTIME_MONOTONIC = 0x202 + BPF_T_BINTIME_MONOTONIC_FAST = 0x302 + BPF_T_FAST = 0x100 + BPF_T_FLAG_MASK = 0x300 + BPF_T_FORMAT_MASK = 0x3 + BPF_T_MICROTIME = 0x0 + BPF_T_MICROTIME_FAST = 0x100 + BPF_T_MICROTIME_MONOTONIC = 0x200 + BPF_T_MICROTIME_MONOTONIC_FAST = 0x300 + BPF_T_MONOTONIC = 0x200 + BPF_T_MONOTONIC_FAST = 0x300 + BPF_T_NANOTIME = 0x1 + BPF_T_NANOTIME_FAST = 0x101 + BPF_T_NANOTIME_MONOTONIC = 0x201 + BPF_T_NANOTIME_MONOTONIC_FAST = 0x301 + BPF_T_NONE = 0x3 + BPF_T_NORMAL = 0x0 + BPF_W = 0x0 + BPF_X = 0x8 + BPF_XOR = 0xa0 + BRKINT = 0x2 + CAP_ACCEPT = 0x200000020000000 + CAP_ACL_CHECK = 0x400000000010000 + CAP_ACL_DELETE = 0x400000000020000 + CAP_ACL_GET = 0x400000000040000 + CAP_ACL_SET = 0x400000000080000 + CAP_ALL0 = 0x20007ffffffffff + CAP_ALL1 = 0x4000000001fffff + CAP_BIND = 0x200000040000000 + CAP_BINDAT = 0x200008000000400 + CAP_CHFLAGSAT = 0x200000000001400 + CAP_CONNECT = 0x200000080000000 + CAP_CONNECTAT = 0x200010000000400 + CAP_CREATE = 0x200000000000040 + CAP_EVENT = 0x400000000000020 + CAP_EXTATTR_DELETE = 0x400000000001000 + CAP_EXTATTR_GET = 0x400000000002000 + CAP_EXTATTR_LIST = 0x400000000004000 + CAP_EXTATTR_SET = 0x400000000008000 + CAP_FCHDIR = 0x200000000000800 + CAP_FCHFLAGS = 0x200000000001000 + CAP_FCHMOD = 0x200000000002000 + CAP_FCHMODAT = 0x200000000002400 + CAP_FCHOWN = 0x200000000004000 + CAP_FCHOWNAT = 0x200000000004400 + CAP_FCNTL = 0x200000000008000 + CAP_FCNTL_ALL = 0x78 + CAP_FCNTL_GETFL = 0x8 + CAP_FCNTL_GETOWN = 0x20 + CAP_FCNTL_SETFL = 0x10 + CAP_FCNTL_SETOWN = 0x40 + CAP_FEXECVE = 0x200000000000080 + CAP_FLOCK = 0x200000000010000 + CAP_FPATHCONF = 0x200000000020000 + CAP_FSCK = 0x200000000040000 + CAP_FSTAT = 0x200000000080000 + CAP_FSTATAT = 0x200000000080400 + CAP_FSTATFS = 0x200000000100000 + CAP_FSYNC = 0x200000000000100 + CAP_FTRUNCATE = 0x200000000000200 + CAP_FUTIMES = 0x200000000200000 + CAP_FUTIMESAT = 0x200000000200400 + CAP_GETPEERNAME = 0x200000100000000 + CAP_GETSOCKNAME = 0x200000200000000 + CAP_GETSOCKOPT = 0x200000400000000 + CAP_IOCTL = 0x400000000000080 + CAP_IOCTLS_ALL = 0x7fffffffffffffff + CAP_KQUEUE = 0x400000000100040 + CAP_KQUEUE_CHANGE = 0x400000000100000 + CAP_KQUEUE_EVENT = 0x400000000000040 + CAP_LINKAT_SOURCE = 0x200020000000400 + CAP_LINKAT_TARGET = 0x200000000400400 + CAP_LISTEN = 0x200000800000000 + CAP_LOOKUP = 0x200000000000400 + CAP_MAC_GET = 0x400000000000001 + CAP_MAC_SET = 0x400000000000002 + CAP_MKDIRAT = 0x200000000800400 + CAP_MKFIFOAT = 0x200000001000400 + CAP_MKNODAT = 0x200000002000400 + CAP_MMAP = 0x200000000000010 + CAP_MMAP_R = 0x20000000000001d + CAP_MMAP_RW = 0x20000000000001f + CAP_MMAP_RWX = 0x20000000000003f + CAP_MMAP_RX = 0x20000000000003d + CAP_MMAP_W = 0x20000000000001e + CAP_MMAP_WX = 0x20000000000003e + CAP_MMAP_X = 0x20000000000003c + CAP_PDGETPID = 0x400000000000200 + CAP_PDKILL = 0x400000000000800 + CAP_PDWAIT = 0x400000000000400 + CAP_PEELOFF = 0x200001000000000 + CAP_POLL_EVENT = 0x400000000000020 + CAP_PREAD = 0x20000000000000d + CAP_PWRITE = 0x20000000000000e + CAP_READ = 0x200000000000001 + CAP_RECV = 0x200000000000001 + CAP_RENAMEAT_SOURCE = 0x200000004000400 + CAP_RENAMEAT_TARGET = 0x200040000000400 + CAP_RIGHTS_VERSION = 0x0 + CAP_RIGHTS_VERSION_00 = 0x0 + CAP_SEEK = 0x20000000000000c + CAP_SEEK_TELL = 0x200000000000004 + CAP_SEM_GETVALUE = 0x400000000000004 + CAP_SEM_POST = 0x400000000000008 + CAP_SEM_WAIT = 0x400000000000010 + CAP_SEND = 0x200000000000002 + CAP_SETSOCKOPT = 0x200002000000000 + CAP_SHUTDOWN = 0x200004000000000 + CAP_SOCK_CLIENT = 0x200007780000003 + CAP_SOCK_SERVER = 0x200007f60000003 + CAP_SYMLINKAT = 0x200000008000400 + CAP_TTYHOOK = 0x400000000000100 + CAP_UNLINKAT = 0x200000010000400 + CAP_UNUSED0_44 = 0x200080000000000 + CAP_UNUSED0_57 = 0x300000000000000 + CAP_UNUSED1_22 = 0x400000000200000 + CAP_UNUSED1_57 = 0x500000000000000 + CAP_WRITE = 0x200000000000002 + CFLUSH = 0xf + CLOCAL = 0x8000 + CLOCK_BOOTTIME = 0x5 + CLOCK_MONOTONIC = 0x4 + CLOCK_MONOTONIC_COARSE = 0xc + CLOCK_MONOTONIC_FAST = 0xc + CLOCK_MONOTONIC_PRECISE = 0xb + CLOCK_PROCESS_CPUTIME_ID = 0xf + CLOCK_PROF = 0x2 + CLOCK_REALTIME = 0x0 + CLOCK_REALTIME_COARSE = 0xa + CLOCK_REALTIME_FAST = 0xa + CLOCK_REALTIME_PRECISE = 0x9 + CLOCK_SECOND = 0xd + CLOCK_THREAD_CPUTIME_ID = 0xe + CLOCK_UPTIME = 0x5 + CLOCK_UPTIME_FAST = 0x8 + CLOCK_UPTIME_PRECISE = 0x7 + CLOCK_VIRTUAL = 0x1 + CPUSTATES = 0x5 + CP_IDLE = 0x4 + CP_INTR = 0x3 + CP_NICE = 0x1 + CP_SYS = 0x2 + CP_USER = 0x0 + CREAD = 0x800 + CRTSCTS = 0x30000 + CS5 = 0x0 + CS6 = 0x100 + CS7 = 0x200 + CS8 = 0x300 + CSIZE = 0x300 + CSTART = 0x11 + CSTATUS = 0x14 + CSTOP = 0x13 + CSTOPB = 0x400 + CSUSP = 0x1a + CTL_HW = 0x6 + CTL_KERN = 0x1 + CTL_MAXNAME = 0x18 + CTL_NET = 0x4 + DIOCGATTR = 0xc148648e + DIOCGDELETE = 0x80106488 + DIOCGFLUSH = 0x20006487 + DIOCGFWHEADS = 0x40046483 + DIOCGFWSECTORS = 0x40046482 + DIOCGIDENT = 0x41006489 + DIOCGKERNELDUMP = 0xc0986492 + DIOCGMEDIASIZE = 0x40086481 + DIOCGPHYSPATH = 0x4400648d + DIOCGPROVIDERNAME = 0x4400648a + DIOCGSECTORSIZE = 0x40046480 + DIOCGSTRIPEOFFSET = 0x4008648c + DIOCGSTRIPESIZE = 0x4008648b + DIOCSKERNELDUMP = 0x80986491 + DIOCSKERNELDUMP_FREEBSD11 = 0x80046485 + DIOCSKERNELDUMP_FREEBSD12 = 0x80506490 + DIOCZONECMD = 0xc080648f + DLT_A429 = 0xb8 + DLT_A653_ICM = 0xb9 + DLT_AIRONET_HEADER = 0x78 + DLT_AOS = 0xde + DLT_APPLE_IP_OVER_IEEE1394 = 0x8a + DLT_ARCNET = 0x7 + DLT_ARCNET_LINUX = 0x81 + DLT_ATM_CLIP = 0x13 + DLT_ATM_RFC1483 = 0xb + DLT_AURORA = 0x7e + DLT_AX25 = 0x3 + DLT_AX25_KISS = 0xca + DLT_BACNET_MS_TP = 0xa5 + DLT_BLUETOOTH_BREDR_BB = 0xff + DLT_BLUETOOTH_HCI_H4 = 0xbb + DLT_BLUETOOTH_HCI_H4_WITH_PHDR = 0xc9 + DLT_BLUETOOTH_LE_LL = 0xfb + DLT_BLUETOOTH_LE_LL_WITH_PHDR = 0x100 + DLT_BLUETOOTH_LINUX_MONITOR = 0xfe + DLT_CAN20B = 0xbe + DLT_CAN_SOCKETCAN = 0xe3 + DLT_CHAOS = 0x5 + DLT_CHDLC = 0x68 + DLT_CISCO_IOS = 0x76 + DLT_CLASS_NETBSD_RAWAF = 0x2240000 + DLT_C_HDLC = 0x68 + DLT_C_HDLC_WITH_DIR = 0xcd + DLT_DBUS = 0xe7 + DLT_DECT = 0xdd + DLT_DISPLAYPORT_AUX = 0x113 + DLT_DOCSIS = 0x8f + DLT_DOCSIS31_XRA31 = 0x111 + DLT_DVB_CI = 0xeb + DLT_ECONET = 0x73 + DLT_EN10MB = 0x1 + DLT_EN3MB = 0x2 + DLT_ENC = 0x6d + DLT_EPON = 0x103 + DLT_ERF = 0xc5 + DLT_ERF_ETH = 0xaf + DLT_ERF_POS = 0xb0 + DLT_ETHERNET_MPACKET = 0x112 + DLT_FC_2 = 0xe0 + DLT_FC_2_WITH_FRAME_DELIMS = 0xe1 + DLT_FDDI = 0xa + DLT_FLEXRAY = 0xd2 + DLT_FRELAY = 0x6b + DLT_FRELAY_WITH_DIR = 0xce + DLT_GCOM_SERIAL = 0xad + DLT_GCOM_T1E1 = 0xac + DLT_GPF_F = 0xab + DLT_GPF_T = 0xaa + DLT_GPRS_LLC = 0xa9 + DLT_GSMTAP_ABIS = 0xda + DLT_GSMTAP_UM = 0xd9 + DLT_IBM_SN = 0x92 + DLT_IBM_SP = 0x91 + DLT_IEEE802 = 0x6 + DLT_IEEE802_11 = 0x69 + DLT_IEEE802_11_RADIO = 0x7f + DLT_IEEE802_11_RADIO_AVS = 0xa3 + DLT_IEEE802_15_4 = 0xc3 + DLT_IEEE802_15_4_LINUX = 0xbf + DLT_IEEE802_15_4_NOFCS = 0xe6 + DLT_IEEE802_15_4_NONASK_PHY = 0xd7 + DLT_IEEE802_16_MAC_CPS = 0xbc + DLT_IEEE802_16_MAC_CPS_RADIO = 0xc1 + DLT_INFINIBAND = 0xf7 + DLT_IPFILTER = 0x74 + DLT_IPMB_KONTRON = 0xc7 + DLT_IPMB_LINUX = 0xd1 + DLT_IPMI_HPM_2 = 0x104 + DLT_IPNET = 0xe2 + DLT_IPOIB = 0xf2 + DLT_IPV4 = 0xe4 + DLT_IPV6 = 0xe5 + DLT_IP_OVER_FC = 0x7a + DLT_ISO_14443 = 0x108 + DLT_JUNIPER_ATM1 = 0x89 + DLT_JUNIPER_ATM2 = 0x87 + DLT_JUNIPER_ATM_CEMIC = 0xee + DLT_JUNIPER_CHDLC = 0xb5 + DLT_JUNIPER_ES = 0x84 + DLT_JUNIPER_ETHER = 0xb2 + DLT_JUNIPER_FIBRECHANNEL = 0xea + DLT_JUNIPER_FRELAY = 0xb4 + DLT_JUNIPER_GGSN = 0x85 + DLT_JUNIPER_ISM = 0xc2 + DLT_JUNIPER_MFR = 0x86 + DLT_JUNIPER_MLFR = 0x83 + DLT_JUNIPER_MLPPP = 0x82 + DLT_JUNIPER_MONITOR = 0xa4 + DLT_JUNIPER_PIC_PEER = 0xae + DLT_JUNIPER_PPP = 0xb3 + DLT_JUNIPER_PPPOE = 0xa7 + DLT_JUNIPER_PPPOE_ATM = 0xa8 + DLT_JUNIPER_SERVICES = 0x88 + DLT_JUNIPER_SRX_E2E = 0xe9 + DLT_JUNIPER_ST = 0xc8 + DLT_JUNIPER_VP = 0xb7 + DLT_JUNIPER_VS = 0xe8 + DLT_LAPB_WITH_DIR = 0xcf + DLT_LAPD = 0xcb + DLT_LIN = 0xd4 + DLT_LINUX_EVDEV = 0xd8 + DLT_LINUX_IRDA = 0x90 + DLT_LINUX_LAPD = 0xb1 + DLT_LINUX_PPP_WITHDIRECTION = 0xa6 + DLT_LINUX_SLL = 0x71 + DLT_LINUX_SLL2 = 0x114 + DLT_LOOP = 0x6c + DLT_LORATAP = 0x10e + DLT_LTALK = 0x72 + DLT_MATCHING_MAX = 0x114 + DLT_MATCHING_MIN = 0x68 + DLT_MFR = 0xb6 + DLT_MOST = 0xd3 + DLT_MPEG_2_TS = 0xf3 + DLT_MPLS = 0xdb + DLT_MTP2 = 0x8c + DLT_MTP2_WITH_PHDR = 0x8b + DLT_MTP3 = 0x8d + DLT_MUX27010 = 0xec + DLT_NETANALYZER = 0xf0 + DLT_NETANALYZER_TRANSPARENT = 0xf1 + DLT_NETLINK = 0xfd + DLT_NFC_LLCP = 0xf5 + DLT_NFLOG = 0xef + DLT_NG40 = 0xf4 + DLT_NORDIC_BLE = 0x110 + DLT_NULL = 0x0 + DLT_OPENFLOW = 0x10b + DLT_PCI_EXP = 0x7d + DLT_PFLOG = 0x75 + DLT_PFSYNC = 0x79 + DLT_PKTAP = 0x102 + DLT_PPI = 0xc0 + DLT_PPP = 0x9 + DLT_PPP_BSDOS = 0xe + DLT_PPP_ETHER = 0x33 + DLT_PPP_PPPD = 0xa6 + DLT_PPP_SERIAL = 0x32 + DLT_PPP_WITH_DIR = 0xcc + DLT_PPP_WITH_DIRECTION = 0xa6 + DLT_PRISM_HEADER = 0x77 + DLT_PROFIBUS_DL = 0x101 + DLT_PRONET = 0x4 + DLT_RAIF1 = 0xc6 + DLT_RAW = 0xc + DLT_RDS = 0x109 + DLT_REDBACK_SMARTEDGE = 0x20 + DLT_RIO = 0x7c + DLT_RTAC_SERIAL = 0xfa + DLT_SCCP = 0x8e + DLT_SCTP = 0xf8 + DLT_SDLC = 0x10c + DLT_SITA = 0xc4 + DLT_SLIP = 0x8 + DLT_SLIP_BSDOS = 0xd + DLT_STANAG_5066_D_PDU = 0xed + DLT_SUNATM = 0x7b + DLT_SYMANTEC_FIREWALL = 0x63 + DLT_TI_LLN_SNIFFER = 0x10d + DLT_TZSP = 0x80 + DLT_USB = 0xba + DLT_USBPCAP = 0xf9 + DLT_USB_DARWIN = 0x10a + DLT_USB_FREEBSD = 0xba + DLT_USB_LINUX = 0xbd + DLT_USB_LINUX_MMAPPED = 0xdc + DLT_USER0 = 0x93 + DLT_USER1 = 0x94 + DLT_USER10 = 0x9d + DLT_USER11 = 0x9e + DLT_USER12 = 0x9f + DLT_USER13 = 0xa0 + DLT_USER14 = 0xa1 + DLT_USER15 = 0xa2 + DLT_USER2 = 0x95 + DLT_USER3 = 0x96 + DLT_USER4 = 0x97 + DLT_USER5 = 0x98 + DLT_USER6 = 0x99 + DLT_USER7 = 0x9a + DLT_USER8 = 0x9b + DLT_USER9 = 0x9c + DLT_VSOCK = 0x10f + DLT_WATTSTOPPER_DLM = 0x107 + DLT_WIHART = 0xdf + DLT_WIRESHARK_UPPER_PDU = 0xfc + DLT_X2E_SERIAL = 0xd5 + DLT_X2E_XORAYA = 0xd6 + DLT_ZWAVE_R1_R2 = 0x105 + DLT_ZWAVE_R3 = 0x106 + DT_BLK = 0x6 + DT_CHR = 0x2 + DT_DIR = 0x4 + DT_FIFO = 0x1 + DT_LNK = 0xa + DT_REG = 0x8 + DT_SOCK = 0xc + DT_UNKNOWN = 0x0 + DT_WHT = 0xe + ECHO = 0x8 + ECHOCTL = 0x40 + ECHOE = 0x2 + ECHOK = 0x4 + ECHOKE = 0x1 + ECHONL = 0x10 + ECHOPRT = 0x20 + EHE_DEAD_PRIORITY = -0x1 + EVFILT_AIO = -0x3 + EVFILT_EMPTY = -0xd + EVFILT_FS = -0x9 + EVFILT_LIO = -0xa + EVFILT_PROC = -0x5 + EVFILT_PROCDESC = -0x8 + EVFILT_READ = -0x1 + EVFILT_SENDFILE = -0xc + EVFILT_SIGNAL = -0x6 + EVFILT_SYSCOUNT = 0xd + EVFILT_TIMER = -0x7 + EVFILT_USER = -0xb + EVFILT_VNODE = -0x4 + EVFILT_WRITE = -0x2 + EVNAMEMAP_NAME_SIZE = 0x40 + EV_ADD = 0x1 + EV_CLEAR = 0x20 + EV_DELETE = 0x2 + EV_DISABLE = 0x8 + EV_DISPATCH = 0x80 + EV_DROP = 0x1000 + EV_ENABLE = 0x4 + EV_EOF = 0x8000 + EV_ERROR = 0x4000 + EV_FLAG1 = 0x2000 + EV_FLAG2 = 0x4000 + EV_FORCEONESHOT = 0x100 + EV_ONESHOT = 0x10 + EV_RECEIPT = 0x40 + EV_SYSFLAGS = 0xf000 + EXTA = 0x4b00 + EXTATTR_MAXNAMELEN = 0xff + EXTATTR_NAMESPACE_EMPTY = 0x0 + EXTATTR_NAMESPACE_SYSTEM = 0x2 + EXTATTR_NAMESPACE_USER = 0x1 + EXTB = 0x9600 + EXTPROC = 0x800 + FD_CLOEXEC = 0x1 + FD_NONE = -0xc8 + FD_SETSIZE = 0x400 + FLUSHO = 0x800000 + F_ADD_SEALS = 0x13 + F_CANCEL = 0x5 + F_DUP2FD = 0xa + F_DUP2FD_CLOEXEC = 0x12 + F_DUPFD = 0x0 + F_DUPFD_CLOEXEC = 0x11 + F_GETFD = 0x1 + F_GETFL = 0x3 + F_GETLK = 0xb + F_GETOWN = 0x5 + F_GET_SEALS = 0x14 + F_ISUNIONSTACK = 0x15 + F_KINFO = 0x16 + F_OGETLK = 0x7 + F_OK = 0x0 + F_OSETLK = 0x8 + F_OSETLKW = 0x9 + F_RDAHEAD = 0x10 + F_RDLCK = 0x1 + F_READAHEAD = 0xf + F_SEAL_GROW = 0x4 + F_SEAL_SEAL = 0x1 + F_SEAL_SHRINK = 0x2 + F_SEAL_WRITE = 0x8 + F_SETFD = 0x2 + F_SETFL = 0x4 + F_SETLK = 0xc + F_SETLKW = 0xd + F_SETLK_REMOTE = 0xe + F_SETOWN = 0x6 + F_UNLCK = 0x2 + F_UNLCKSYS = 0x4 + F_WRLCK = 0x3 + HUPCL = 0x4000 + HW_MACHINE = 0x1 + ICANON = 0x100 + ICMP6_FILTER = 0x12 + ICRNL = 0x100 + IEXTEN = 0x400 + IFAN_ARRIVAL = 0x0 + IFAN_DEPARTURE = 0x1 + IFCAP_WOL_MAGIC = 0x2000 + IFF_ALLMULTI = 0x200 + IFF_ALTPHYS = 0x4000 + IFF_BROADCAST = 0x2 + IFF_CANTCHANGE = 0x218f72 + IFF_CANTCONFIG = 0x10000 + IFF_DEBUG = 0x4 + IFF_DRV_OACTIVE = 0x400 + IFF_DRV_RUNNING = 0x40 + IFF_DYING = 0x200000 + IFF_KNOWSEPOCH = 0x20 + IFF_LINK0 = 0x1000 + IFF_LINK1 = 0x2000 + IFF_LINK2 = 0x4000 + IFF_LOOPBACK = 0x8 + IFF_MONITOR = 0x40000 + IFF_MULTICAST = 0x8000 + IFF_NOARP = 0x80 + IFF_NOGROUP = 0x800000 + IFF_OACTIVE = 0x400 + IFF_POINTOPOINT = 0x10 + IFF_PPROMISC = 0x20000 + IFF_PROMISC = 0x100 + IFF_RENAMING = 0x400000 + IFF_RUNNING = 0x40 + IFF_SIMPLEX = 0x800 + IFF_STATICARP = 0x80000 + IFF_UP = 0x1 + IFNAMSIZ = 0x10 + IFT_BRIDGE = 0xd1 + IFT_CARP = 0xf8 + IFT_IEEE1394 = 0x90 + IFT_INFINIBAND = 0xc7 + IFT_L2VLAN = 0x87 + IFT_L3IPVLAN = 0x88 + IFT_PPP = 0x17 + IFT_PROPVIRTUAL = 0x35 + IGNBRK = 0x1 + IGNCR = 0x80 + IGNPAR = 0x4 + IMAXBEL = 0x2000 + INLCR = 0x40 + INPCK = 0x10 + IN_CLASSA_HOST = 0xffffff + IN_CLASSA_MAX = 0x80 + IN_CLASSA_NET = 0xff000000 + IN_CLASSA_NSHIFT = 0x18 + IN_CLASSB_HOST = 0xffff + IN_CLASSB_MAX = 0x10000 + IN_CLASSB_NET = 0xffff0000 + IN_CLASSB_NSHIFT = 0x10 + IN_CLASSC_HOST = 0xff + IN_CLASSC_NET = 0xffffff00 + IN_CLASSC_NSHIFT = 0x8 + IN_CLASSD_HOST = 0xfffffff + IN_CLASSD_NET = 0xf0000000 + IN_CLASSD_NSHIFT = 0x1c + IN_LOOPBACKNET = 0x7f + IN_NETMASK_DEFAULT = 0xffffff00 + IN_RFC3021_MASK = 0xfffffffe + IPPROTO_3PC = 0x22 + IPPROTO_ADFS = 0x44 + IPPROTO_AH = 0x33 + IPPROTO_AHIP = 0x3d + IPPROTO_APES = 0x63 + IPPROTO_ARGUS = 0xd + IPPROTO_AX25 = 0x5d + IPPROTO_BHA = 0x31 + IPPROTO_BLT = 0x1e + IPPROTO_BRSATMON = 0x4c + IPPROTO_CARP = 0x70 + IPPROTO_CFTP = 0x3e + IPPROTO_CHAOS = 0x10 + IPPROTO_CMTP = 0x26 + IPPROTO_CPHB = 0x49 + IPPROTO_CPNX = 0x48 + IPPROTO_DCCP = 0x21 + IPPROTO_DDP = 0x25 + IPPROTO_DGP = 0x56 + IPPROTO_DIVERT = 0x102 + IPPROTO_DONE = 0x101 + IPPROTO_DSTOPTS = 0x3c + IPPROTO_EGP = 0x8 + IPPROTO_EMCON = 0xe + IPPROTO_ENCAP = 0x62 + IPPROTO_EON = 0x50 + IPPROTO_ESP = 0x32 + IPPROTO_ETHERIP = 0x61 + IPPROTO_FRAGMENT = 0x2c + IPPROTO_GGP = 0x3 + IPPROTO_GMTP = 0x64 + IPPROTO_GRE = 0x2f + IPPROTO_HELLO = 0x3f + IPPROTO_HIP = 0x8b + IPPROTO_HMP = 0x14 + IPPROTO_HOPOPTS = 0x0 + IPPROTO_ICMP = 0x1 + IPPROTO_ICMPV6 = 0x3a + IPPROTO_IDP = 0x16 + IPPROTO_IDPR = 0x23 + IPPROTO_IDRP = 0x2d + IPPROTO_IGMP = 0x2 + IPPROTO_IGP = 0x55 + IPPROTO_IGRP = 0x58 + IPPROTO_IL = 0x28 + IPPROTO_INLSP = 0x34 + IPPROTO_INP = 0x20 + IPPROTO_IP = 0x0 + IPPROTO_IPCOMP = 0x6c + IPPROTO_IPCV = 0x47 + IPPROTO_IPEIP = 0x5e + IPPROTO_IPIP = 0x4 + IPPROTO_IPPC = 0x43 + IPPROTO_IPV4 = 0x4 + IPPROTO_IPV6 = 0x29 + IPPROTO_IRTP = 0x1c + IPPROTO_KRYPTOLAN = 0x41 + IPPROTO_LARP = 0x5b + IPPROTO_LEAF1 = 0x19 + IPPROTO_LEAF2 = 0x1a + IPPROTO_MAX = 0x100 + IPPROTO_MEAS = 0x13 + IPPROTO_MH = 0x87 + IPPROTO_MHRP = 0x30 + IPPROTO_MICP = 0x5f + IPPROTO_MOBILE = 0x37 + IPPROTO_MPLS = 0x89 + IPPROTO_MTP = 0x5c + IPPROTO_MUX = 0x12 + IPPROTO_ND = 0x4d + IPPROTO_NHRP = 0x36 + IPPROTO_NONE = 0x3b + IPPROTO_NSP = 0x1f + IPPROTO_NVPII = 0xb + IPPROTO_OLD_DIVERT = 0xfe + IPPROTO_OSPFIGP = 0x59 + IPPROTO_PFSYNC = 0xf0 + IPPROTO_PGM = 0x71 + IPPROTO_PIGP = 0x9 + IPPROTO_PIM = 0x67 + IPPROTO_PRM = 0x15 + IPPROTO_PUP = 0xc + IPPROTO_PVP = 0x4b + IPPROTO_RAW = 0xff + IPPROTO_RCCMON = 0xa + IPPROTO_RDP = 0x1b + IPPROTO_RESERVED_253 = 0xfd + IPPROTO_RESERVED_254 = 0xfe + IPPROTO_ROUTING = 0x2b + IPPROTO_RSVP = 0x2e + IPPROTO_RVD = 0x42 + IPPROTO_SATEXPAK = 0x40 + IPPROTO_SATMON = 0x45 + IPPROTO_SCCSP = 0x60 + IPPROTO_SCTP = 0x84 + IPPROTO_SDRP = 0x2a + IPPROTO_SEND = 0x103 + IPPROTO_SHIM6 = 0x8c + IPPROTO_SKIP = 0x39 + IPPROTO_SPACER = 0x7fff + IPPROTO_SRPC = 0x5a + IPPROTO_ST = 0x7 + IPPROTO_SVMTP = 0x52 + IPPROTO_SWIPE = 0x35 + IPPROTO_TCF = 0x57 + IPPROTO_TCP = 0x6 + IPPROTO_TLSP = 0x38 + IPPROTO_TP = 0x1d + IPPROTO_TPXX = 0x27 + IPPROTO_TRUNK1 = 0x17 + IPPROTO_TRUNK2 = 0x18 + IPPROTO_TTP = 0x54 + IPPROTO_UDP = 0x11 + IPPROTO_UDPLITE = 0x88 + IPPROTO_VINES = 0x53 + IPPROTO_VISA = 0x46 + IPPROTO_VMTP = 0x51 + IPPROTO_WBEXPAK = 0x4f + IPPROTO_WBMON = 0x4e + IPPROTO_WSN = 0x4a + IPPROTO_XNET = 0xf + IPPROTO_XTP = 0x24 + IPV6_AUTOFLOWLABEL = 0x3b + IPV6_BINDANY = 0x40 + IPV6_BINDMULTI = 0x41 + IPV6_BINDV6ONLY = 0x1b + IPV6_CHECKSUM = 0x1a + IPV6_DEFAULT_MULTICAST_HOPS = 0x1 + IPV6_DEFAULT_MULTICAST_LOOP = 0x1 + IPV6_DEFHLIM = 0x40 + IPV6_DONTFRAG = 0x3e + IPV6_DSTOPTS = 0x32 + IPV6_FLOWID = 0x43 + IPV6_FLOWINFO_MASK = 0xffffff0f + IPV6_FLOWLABEL_LEN = 0x14 + IPV6_FLOWLABEL_MASK = 0xffff0f00 + IPV6_FLOWTYPE = 0x44 + IPV6_FRAGTTL = 0x78 + IPV6_FW_ADD = 0x1e + IPV6_FW_DEL = 0x1f + IPV6_FW_FLUSH = 0x20 + IPV6_FW_GET = 0x22 + IPV6_FW_ZERO = 0x21 + IPV6_HLIMDEC = 0x1 + IPV6_HOPLIMIT = 0x2f + IPV6_HOPOPTS = 0x31 + IPV6_IPSEC_POLICY = 0x1c + IPV6_JOIN_GROUP = 0xc + IPV6_LEAVE_GROUP = 0xd + IPV6_MAXHLIM = 0xff + IPV6_MAXOPTHDR = 0x800 + IPV6_MAXPACKET = 0xffff + IPV6_MAX_GROUP_SRC_FILTER = 0x200 + IPV6_MAX_MEMBERSHIPS = 0xfff + IPV6_MAX_SOCK_SRC_FILTER = 0x80 + IPV6_MMTU = 0x500 + IPV6_MSFILTER = 0x4a + IPV6_MULTICAST_HOPS = 0xa + IPV6_MULTICAST_IF = 0x9 + IPV6_MULTICAST_LOOP = 0xb + IPV6_NEXTHOP = 0x30 + IPV6_ORIGDSTADDR = 0x48 + IPV6_PATHMTU = 0x2c + IPV6_PKTINFO = 0x2e + IPV6_PORTRANGE = 0xe + IPV6_PORTRANGE_DEFAULT = 0x0 + IPV6_PORTRANGE_HIGH = 0x1 + IPV6_PORTRANGE_LOW = 0x2 + IPV6_PREFER_TEMPADDR = 0x3f + IPV6_RECVDSTOPTS = 0x28 + IPV6_RECVFLOWID = 0x46 + IPV6_RECVHOPLIMIT = 0x25 + IPV6_RECVHOPOPTS = 0x27 + IPV6_RECVORIGDSTADDR = 0x48 + IPV6_RECVPATHMTU = 0x2b + IPV6_RECVPKTINFO = 0x24 + IPV6_RECVRSSBUCKETID = 0x47 + IPV6_RECVRTHDR = 0x26 + IPV6_RECVTCLASS = 0x39 + IPV6_RSSBUCKETID = 0x45 + IPV6_RSS_LISTEN_BUCKET = 0x42 + IPV6_RTHDR = 0x33 + IPV6_RTHDRDSTOPTS = 0x23 + IPV6_RTHDR_LOOSE = 0x0 + IPV6_RTHDR_STRICT = 0x1 + IPV6_RTHDR_TYPE_0 = 0x0 + IPV6_SOCKOPT_RESERVED1 = 0x3 + IPV6_TCLASS = 0x3d + IPV6_UNICAST_HOPS = 0x4 + IPV6_USE_MIN_MTU = 0x2a + IPV6_V6ONLY = 0x1b + IPV6_VERSION = 0x60 + IPV6_VERSION_MASK = 0xf0 + IPV6_VLAN_PCP = 0x4b + IP_ADD_MEMBERSHIP = 0xc + IP_ADD_SOURCE_MEMBERSHIP = 0x46 + IP_BINDANY = 0x18 + IP_BINDMULTI = 0x19 + IP_BLOCK_SOURCE = 0x48 + IP_DEFAULT_MULTICAST_LOOP = 0x1 + IP_DEFAULT_MULTICAST_TTL = 0x1 + IP_DF = 0x4000 + IP_DONTFRAG = 0x43 + IP_DROP_MEMBERSHIP = 0xd + IP_DROP_SOURCE_MEMBERSHIP = 0x47 + IP_DUMMYNET3 = 0x31 + IP_DUMMYNET_CONFIGURE = 0x3c + IP_DUMMYNET_DEL = 0x3d + IP_DUMMYNET_FLUSH = 0x3e + IP_DUMMYNET_GET = 0x40 + IP_FLOWID = 0x5a + IP_FLOWTYPE = 0x5b + IP_FW3 = 0x30 + IP_FW_ADD = 0x32 + IP_FW_DEL = 0x33 + IP_FW_FLUSH = 0x34 + IP_FW_GET = 0x36 + IP_FW_NAT_CFG = 0x38 + IP_FW_NAT_DEL = 0x39 + IP_FW_NAT_GET_CONFIG = 0x3a + IP_FW_NAT_GET_LOG = 0x3b + IP_FW_RESETLOG = 0x37 + IP_FW_TABLE_ADD = 0x28 + IP_FW_TABLE_DEL = 0x29 + IP_FW_TABLE_FLUSH = 0x2a + IP_FW_TABLE_GETSIZE = 0x2b + IP_FW_TABLE_LIST = 0x2c + IP_FW_ZERO = 0x35 + IP_HDRINCL = 0x2 + IP_IPSEC_POLICY = 0x15 + IP_MAXPACKET = 0xffff + IP_MAX_GROUP_SRC_FILTER = 0x200 + IP_MAX_MEMBERSHIPS = 0xfff + IP_MAX_SOCK_MUTE_FILTER = 0x80 + IP_MAX_SOCK_SRC_FILTER = 0x80 + IP_MF = 0x2000 + IP_MINTTL = 0x42 + IP_MSFILTER = 0x4a + IP_MSS = 0x240 + IP_MULTICAST_IF = 0x9 + IP_MULTICAST_LOOP = 0xb + IP_MULTICAST_TTL = 0xa + IP_MULTICAST_VIF = 0xe + IP_OFFMASK = 0x1fff + IP_ONESBCAST = 0x17 + IP_OPTIONS = 0x1 + IP_ORIGDSTADDR = 0x1b + IP_PORTRANGE = 0x13 + IP_PORTRANGE_DEFAULT = 0x0 + IP_PORTRANGE_HIGH = 0x1 + IP_PORTRANGE_LOW = 0x2 + IP_RECVDSTADDR = 0x7 + IP_RECVFLOWID = 0x5d + IP_RECVIF = 0x14 + IP_RECVOPTS = 0x5 + IP_RECVORIGDSTADDR = 0x1b + IP_RECVRETOPTS = 0x6 + IP_RECVRSSBUCKETID = 0x5e + IP_RECVTOS = 0x44 + IP_RECVTTL = 0x41 + IP_RETOPTS = 0x8 + IP_RF = 0x8000 + IP_RSSBUCKETID = 0x5c + IP_RSS_LISTEN_BUCKET = 0x1a + IP_RSVP_OFF = 0x10 + IP_RSVP_ON = 0xf + IP_RSVP_VIF_OFF = 0x12 + IP_RSVP_VIF_ON = 0x11 + IP_SENDSRCADDR = 0x7 + IP_TOS = 0x3 + IP_TTL = 0x4 + IP_UNBLOCK_SOURCE = 0x49 + IP_VLAN_PCP = 0x4b + ISIG = 0x80 + ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 + IXANY = 0x800 + IXOFF = 0x400 + IXON = 0x200 + KERN_HOSTNAME = 0xa + KERN_OSRELEASE = 0x2 + KERN_OSTYPE = 0x1 + KERN_VERSION = 0x4 + LOCAL_CONNWAIT = 0x4 + LOCAL_CREDS = 0x2 + LOCAL_CREDS_PERSISTENT = 0x3 + LOCAL_PEERCRED = 0x1 + LOCAL_VENDOR = 0x80000000 + LOCK_EX = 0x2 + LOCK_NB = 0x4 + LOCK_SH = 0x1 + LOCK_UN = 0x8 + MADV_AUTOSYNC = 0x7 + MADV_CORE = 0x9 + MADV_DONTNEED = 0x4 + MADV_FREE = 0x5 + MADV_NOCORE = 0x8 + MADV_NORMAL = 0x0 + MADV_NOSYNC = 0x6 + MADV_PROTECT = 0xa + MADV_RANDOM = 0x1 + MADV_SEQUENTIAL = 0x2 + MADV_WILLNEED = 0x3 + MAP_32BIT = 0x80000 + MAP_ALIGNED_SUPER = 0x1000000 + MAP_ALIGNMENT_MASK = -0x1000000 + MAP_ALIGNMENT_SHIFT = 0x18 + MAP_ANON = 0x1000 + MAP_ANONYMOUS = 0x1000 + MAP_COPY = 0x2 + MAP_EXCL = 0x4000 + MAP_FILE = 0x0 + MAP_FIXED = 0x10 + MAP_GUARD = 0x2000 + MAP_HASSEMAPHORE = 0x200 + MAP_NOCORE = 0x20000 + MAP_NOSYNC = 0x800 + MAP_PREFAULT_READ = 0x40000 + MAP_PRIVATE = 0x2 + MAP_RESERVED0020 = 0x20 + MAP_RESERVED0040 = 0x40 + MAP_RESERVED0080 = 0x80 + MAP_RESERVED0100 = 0x100 + MAP_SHARED = 0x1 + MAP_STACK = 0x400 + MCAST_BLOCK_SOURCE = 0x54 + MCAST_EXCLUDE = 0x2 + MCAST_INCLUDE = 0x1 + MCAST_JOIN_GROUP = 0x50 + MCAST_JOIN_SOURCE_GROUP = 0x52 + MCAST_LEAVE_GROUP = 0x51 + MCAST_LEAVE_SOURCE_GROUP = 0x53 + MCAST_UNBLOCK_SOURCE = 0x55 + MCAST_UNDEFINED = 0x0 + MCL_CURRENT = 0x1 + MCL_FUTURE = 0x2 + MFD_ALLOW_SEALING = 0x2 + MFD_CLOEXEC = 0x1 + MFD_HUGETLB = 0x4 + MFD_HUGE_16GB = -0x78000000 + MFD_HUGE_16MB = 0x60000000 + MFD_HUGE_1GB = 0x78000000 + MFD_HUGE_1MB = 0x50000000 + MFD_HUGE_256MB = 0x70000000 + MFD_HUGE_2GB = 0x7c000000 + MFD_HUGE_2MB = 0x54000000 + MFD_HUGE_32MB = 0x64000000 + MFD_HUGE_512KB = 0x4c000000 + MFD_HUGE_512MB = 0x74000000 + MFD_HUGE_64KB = 0x40000000 + MFD_HUGE_8MB = 0x5c000000 + MFD_HUGE_MASK = 0xfc000000 + MFD_HUGE_SHIFT = 0x1a + MNT_ACLS = 0x8000000 + MNT_ASYNC = 0x40 + MNT_AUTOMOUNTED = 0x200000000 + MNT_BYFSID = 0x8000000 + MNT_CMDFLAGS = 0x300d0f0000 + MNT_DEFEXPORTED = 0x200 + MNT_DELEXPORT = 0x20000 + MNT_EMPTYDIR = 0x2000000000 + MNT_EXKERB = 0x800 + MNT_EXPORTANON = 0x400 + MNT_EXPORTED = 0x100 + MNT_EXPUBLIC = 0x20000000 + MNT_EXRDONLY = 0x80 + MNT_EXTLS = 0x4000000000 + MNT_EXTLSCERT = 0x8000000000 + MNT_EXTLSCERTUSER = 0x10000000000 + MNT_FORCE = 0x80000 + MNT_GJOURNAL = 0x2000000 + MNT_IGNORE = 0x800000 + MNT_LAZY = 0x3 + MNT_LOCAL = 0x1000 + MNT_MULTILABEL = 0x4000000 + MNT_NFS4ACLS = 0x10 + MNT_NOATIME = 0x10000000 + MNT_NOCLUSTERR = 0x40000000 + MNT_NOCLUSTERW = 0x80000000 + MNT_NOCOVER = 0x1000000000 + MNT_NOEXEC = 0x4 + MNT_NONBUSY = 0x4000000 + MNT_NOSUID = 0x8 + MNT_NOSYMFOLLOW = 0x400000 + MNT_NOWAIT = 0x2 + MNT_QUOTA = 0x2000 + MNT_RDONLY = 0x1 + MNT_RELOAD = 0x40000 + MNT_ROOTFS = 0x4000 + MNT_SNAPSHOT = 0x1000000 + MNT_SOFTDEP = 0x200000 + MNT_SUIDDIR = 0x100000 + MNT_SUJ = 0x100000000 + MNT_SUSPEND = 0x4 + MNT_SYNCHRONOUS = 0x2 + MNT_UNION = 0x20 + MNT_UNTRUSTED = 0x800000000 + MNT_UPDATE = 0x10000 + MNT_UPDATEMASK = 0xad8d0807e + MNT_USER = 0x8000 + MNT_VERIFIED = 0x400000000 + MNT_VISFLAGMASK = 0xffef0ffff + MNT_WAIT = 0x1 + MSG_CMSG_CLOEXEC = 0x40000 + MSG_COMPAT = 0x8000 + MSG_CTRUNC = 0x20 + MSG_DONTROUTE = 0x4 + MSG_DONTWAIT = 0x80 + MSG_EOF = 0x100 + MSG_EOR = 0x8 + MSG_NBIO = 0x4000 + MSG_NOSIGNAL = 0x20000 + MSG_NOTIFICATION = 0x2000 + MSG_OOB = 0x1 + MSG_PEEK = 0x2 + MSG_TRUNC = 0x10 + MSG_WAITALL = 0x40 + MSG_WAITFORONE = 0x80000 + MS_ASYNC = 0x1 + MS_INVALIDATE = 0x2 + MS_SYNC = 0x0 + NAME_MAX = 0xff + NET_RT_DUMP = 0x1 + NET_RT_FLAGS = 0x2 + NET_RT_IFLIST = 0x3 + NET_RT_IFLISTL = 0x5 + NET_RT_IFMALIST = 0x4 + NET_RT_NHGRP = 0x7 + NET_RT_NHOP = 0x6 + NFDBITS = 0x40 + NOFLSH = 0x80000000 + NOKERNINFO = 0x2000000 + NOTE_ABSTIME = 0x10 + NOTE_ATTRIB = 0x8 + NOTE_CHILD = 0x4 + NOTE_CLOSE = 0x100 + NOTE_CLOSE_WRITE = 0x200 + NOTE_DELETE = 0x1 + NOTE_EXEC = 0x20000000 + NOTE_EXIT = 0x80000000 + NOTE_EXTEND = 0x4 + NOTE_FFAND = 0x40000000 + NOTE_FFCOPY = 0xc0000000 + NOTE_FFCTRLMASK = 0xc0000000 + NOTE_FFLAGSMASK = 0xffffff + NOTE_FFNOP = 0x0 + NOTE_FFOR = 0x80000000 + NOTE_FILE_POLL = 0x2 + NOTE_FORK = 0x40000000 + NOTE_LINK = 0x10 + NOTE_LOWAT = 0x1 + NOTE_MSECONDS = 0x2 + NOTE_NSECONDS = 0x8 + NOTE_OPEN = 0x80 + NOTE_PCTRLMASK = 0xf0000000 + NOTE_PDATAMASK = 0xfffff + NOTE_READ = 0x400 + NOTE_RENAME = 0x20 + NOTE_REVOKE = 0x40 + NOTE_SECONDS = 0x1 + NOTE_TRACK = 0x1 + NOTE_TRACKERR = 0x2 + NOTE_TRIGGER = 0x1000000 + NOTE_USECONDS = 0x4 + NOTE_WRITE = 0x2 + OCRNL = 0x10 + ONLCR = 0x2 + ONLRET = 0x40 + ONOCR = 0x20 + ONOEOT = 0x8 + OPOST = 0x1 + OXTABS = 0x4 + O_ACCMODE = 0x3 + O_APPEND = 0x8 + O_ASYNC = 0x40 + O_CLOEXEC = 0x100000 + O_CREAT = 0x200 + O_DIRECT = 0x10000 + O_DIRECTORY = 0x20000 + O_DSYNC = 0x1000000 + O_EMPTY_PATH = 0x2000000 + O_EXCL = 0x800 + O_EXEC = 0x40000 + O_EXLOCK = 0x20 + O_FSYNC = 0x80 + O_NDELAY = 0x4 + O_NOCTTY = 0x8000 + O_NOFOLLOW = 0x100 + O_NONBLOCK = 0x4 + O_PATH = 0x400000 + O_RDONLY = 0x0 + O_RDWR = 0x2 + O_RESOLVE_BENEATH = 0x800000 + O_SEARCH = 0x40000 + O_SHLOCK = 0x10 + O_SYNC = 0x80 + O_TRUNC = 0x400 + O_TTY_INIT = 0x80000 + O_VERIFY = 0x200000 + O_WRONLY = 0x1 + PARENB = 0x1000 + PARMRK = 0x8 + PARODD = 0x2000 + PENDIN = 0x20000000 + PIOD_READ_D = 0x1 + PIOD_READ_I = 0x3 + PIOD_WRITE_D = 0x2 + PIOD_WRITE_I = 0x4 + PRIO_PGRP = 0x1 + PRIO_PROCESS = 0x0 + PRIO_USER = 0x2 + PROT_EXEC = 0x4 + PROT_NONE = 0x0 + PROT_READ = 0x1 + PROT_WRITE = 0x2 + PTRACE_DEFAULT = 0x1 + PTRACE_EXEC = 0x1 + PTRACE_FORK = 0x8 + PTRACE_LWP = 0x10 + PTRACE_SCE = 0x2 + PTRACE_SCX = 0x4 + PTRACE_SYSCALL = 0x6 + PTRACE_VFORK = 0x20 + PT_ATTACH = 0xa + PT_CLEARSTEP = 0x10 + PT_CONTINUE = 0x7 + PT_COREDUMP = 0x1d + PT_DETACH = 0xb + PT_FIRSTMACH = 0x40 + PT_FOLLOW_FORK = 0x17 + PT_GETDBREGS = 0x25 + PT_GETFPREGS = 0x23 + PT_GETLWPLIST = 0xf + PT_GETNUMLWPS = 0xe + PT_GETREGS = 0x21 + PT_GET_EVENT_MASK = 0x19 + PT_GET_SC_ARGS = 0x1b + PT_GET_SC_RET = 0x1c + PT_IO = 0xc + PT_KILL = 0x8 + PT_LWPINFO = 0xd + PT_LWP_EVENTS = 0x18 + PT_READ_D = 0x2 + PT_READ_I = 0x1 + PT_RESUME = 0x13 + PT_SETDBREGS = 0x26 + PT_SETFPREGS = 0x24 + PT_SETREGS = 0x22 + PT_SETSTEP = 0x11 + PT_SET_EVENT_MASK = 0x1a + PT_STEP = 0x9 + PT_SUSPEND = 0x12 + PT_SYSCALL = 0x16 + PT_TO_SCE = 0x14 + PT_TO_SCX = 0x15 + PT_TRACE_ME = 0x0 + PT_VM_ENTRY = 0x29 + PT_VM_TIMESTAMP = 0x28 + PT_WRITE_D = 0x5 + PT_WRITE_I = 0x4 + P_ZONEID = 0xc + RLIMIT_AS = 0xa + RLIMIT_CORE = 0x4 + RLIMIT_CPU = 0x0 + RLIMIT_DATA = 0x2 + RLIMIT_FSIZE = 0x1 + RLIMIT_MEMLOCK = 0x6 + RLIMIT_NOFILE = 0x8 + RLIMIT_NPROC = 0x7 + RLIMIT_RSS = 0x5 + RLIMIT_STACK = 0x3 + RLIM_INFINITY = 0x7fffffffffffffff + RTAX_AUTHOR = 0x6 + RTAX_BRD = 0x7 + RTAX_DST = 0x0 + RTAX_GATEWAY = 0x1 + RTAX_GENMASK = 0x3 + RTAX_IFA = 0x5 + RTAX_IFP = 0x4 + RTAX_MAX = 0x8 + RTAX_NETMASK = 0x2 + RTA_AUTHOR = 0x40 + RTA_BRD = 0x80 + RTA_DST = 0x1 + RTA_GATEWAY = 0x2 + RTA_GENMASK = 0x8 + RTA_IFA = 0x20 + RTA_IFP = 0x10 + RTA_NETMASK = 0x4 + RTF_BLACKHOLE = 0x1000 + RTF_BROADCAST = 0x400000 + RTF_DONE = 0x40 + RTF_DYNAMIC = 0x10 + RTF_FIXEDMTU = 0x80000 + RTF_FMASK = 0x1004d808 + RTF_GATEWAY = 0x2 + RTF_GWFLAG_COMPAT = 0x80000000 + RTF_HOST = 0x4 + RTF_LLDATA = 0x400 + RTF_LLINFO = 0x400 + RTF_LOCAL = 0x200000 + RTF_MODIFIED = 0x20 + RTF_MULTICAST = 0x800000 + RTF_PINNED = 0x100000 + RTF_PROTO1 = 0x8000 + RTF_PROTO2 = 0x4000 + RTF_PROTO3 = 0x40000 + RTF_REJECT = 0x8 + RTF_STATIC = 0x800 + RTF_STICKY = 0x10000000 + RTF_UP = 0x1 + RTF_XRESOLVE = 0x200 + RTM_ADD = 0x1 + RTM_CHANGE = 0x3 + RTM_DELADDR = 0xd + RTM_DELETE = 0x2 + RTM_DELMADDR = 0x10 + RTM_GET = 0x4 + RTM_IEEE80211 = 0x12 + RTM_IFANNOUNCE = 0x11 + RTM_IFINFO = 0xe + RTM_LOCK = 0x8 + RTM_LOSING = 0x5 + RTM_MISS = 0x7 + RTM_NEWADDR = 0xc + RTM_NEWMADDR = 0xf + RTM_REDIRECT = 0x6 + RTM_RESOLVE = 0xb + RTM_RTTUNIT = 0xf4240 + RTM_VERSION = 0x5 + RTV_EXPIRE = 0x4 + RTV_HOPCOUNT = 0x2 + RTV_MTU = 0x1 + RTV_RPIPE = 0x8 + RTV_RTT = 0x40 + RTV_RTTVAR = 0x80 + RTV_SPIPE = 0x10 + RTV_SSTHRESH = 0x20 + RTV_WEIGHT = 0x100 + RT_ALL_FIBS = -0x1 + RT_BLACKHOLE = 0x40 + RT_DEFAULT_FIB = 0x0 + RT_DEFAULT_WEIGHT = 0x1 + RT_HAS_GW = 0x80 + RT_HAS_HEADER = 0x10 + RT_HAS_HEADER_BIT = 0x4 + RT_L2_ME = 0x4 + RT_L2_ME_BIT = 0x2 + RT_LLE_CACHE = 0x100 + RT_MAX_WEIGHT = 0xffffff + RT_MAY_LOOP = 0x8 + RT_MAY_LOOP_BIT = 0x3 + RT_REJECT = 0x20 + RUSAGE_CHILDREN = -0x1 + RUSAGE_SELF = 0x0 + RUSAGE_THREAD = 0x1 + SCM_BINTIME = 0x4 + SCM_CREDS = 0x3 + SCM_CREDS2 = 0x8 + SCM_MONOTONIC = 0x6 + SCM_REALTIME = 0x5 + SCM_RIGHTS = 0x1 + SCM_TIMESTAMP = 0x2 + SCM_TIME_INFO = 0x7 + SEEK_CUR = 0x1 + SEEK_DATA = 0x3 + SEEK_END = 0x2 + SEEK_HOLE = 0x4 + SEEK_SET = 0x0 + SHUT_RD = 0x0 + SHUT_RDWR = 0x2 + SHUT_WR = 0x1 + SIOCADDMULTI = 0x80206931 + SIOCAIFADDR = 0x8040691a + SIOCAIFGROUP = 0x80286987 + SIOCATMARK = 0x40047307 + SIOCDELMULTI = 0x80206932 + SIOCDIFADDR = 0x80206919 + SIOCDIFGROUP = 0x80286989 + SIOCDIFPHYADDR = 0x80206949 + SIOCGDRVSPEC = 0xc028697b + SIOCGETSGCNT = 0xc0207210 + SIOCGETVIFCNT = 0xc028720f + SIOCGHIWAT = 0x40047301 + SIOCGHWADDR = 0xc020693e + SIOCGI2C = 0xc020693d + SIOCGIFADDR = 0xc0206921 + SIOCGIFALIAS = 0xc044692d + SIOCGIFBRDADDR = 0xc0206923 + SIOCGIFCAP = 0xc020691f + SIOCGIFCONF = 0xc0106924 + SIOCGIFDATA = 0x8020692c + SIOCGIFDESCR = 0xc020692a + SIOCGIFDOWNREASON = 0xc058699a + SIOCGIFDSTADDR = 0xc0206922 + SIOCGIFFIB = 0xc020695c + SIOCGIFFLAGS = 0xc0206911 + SIOCGIFGENERIC = 0xc020693a + SIOCGIFGMEMB = 0xc028698a + SIOCGIFGROUP = 0xc0286988 + SIOCGIFINDEX = 0xc0206920 + SIOCGIFMAC = 0xc0206926 + SIOCGIFMEDIA = 0xc0306938 + SIOCGIFMETRIC = 0xc0206917 + SIOCGIFMTU = 0xc0206933 + SIOCGIFNETMASK = 0xc0206925 + SIOCGIFPDSTADDR = 0xc0206948 + SIOCGIFPHYS = 0xc0206935 + SIOCGIFPSRCADDR = 0xc0206947 + SIOCGIFRSSHASH = 0xc0186997 + SIOCGIFRSSKEY = 0xc0946996 + SIOCGIFSTATUS = 0xc331693b + SIOCGIFXMEDIA = 0xc030698b + SIOCGLANPCP = 0xc0206998 + SIOCGLOWAT = 0x40047303 + SIOCGPGRP = 0x40047309 + SIOCGPRIVATE_0 = 0xc0206950 + SIOCGPRIVATE_1 = 0xc0206951 + SIOCGTUNFIB = 0xc020695e + SIOCIFCREATE = 0xc020697a + SIOCIFCREATE2 = 0xc020697c + SIOCIFDESTROY = 0x80206979 + SIOCIFGCLONERS = 0xc0106978 + SIOCSDRVSPEC = 0x8028697b + SIOCSHIWAT = 0x80047300 + SIOCSIFADDR = 0x8020690c + SIOCSIFBRDADDR = 0x80206913 + SIOCSIFCAP = 0x8020691e + SIOCSIFDESCR = 0x80206929 + SIOCSIFDSTADDR = 0x8020690e + SIOCSIFFIB = 0x8020695d + SIOCSIFFLAGS = 0x80206910 + SIOCSIFGENERIC = 0x80206939 + SIOCSIFLLADDR = 0x8020693c + SIOCSIFMAC = 0x80206927 + SIOCSIFMEDIA = 0xc0206937 + SIOCSIFMETRIC = 0x80206918 + SIOCSIFMTU = 0x80206934 + SIOCSIFNAME = 0x80206928 + SIOCSIFNETMASK = 0x80206916 + SIOCSIFPHYADDR = 0x80406946 + SIOCSIFPHYS = 0x80206936 + SIOCSIFRVNET = 0xc020695b + SIOCSIFVNET = 0xc020695a + SIOCSLANPCP = 0x80206999 + SIOCSLOWAT = 0x80047302 + SIOCSPGRP = 0x80047308 + SIOCSTUNFIB = 0x8020695f + SOCK_CLOEXEC = 0x10000000 + SOCK_DGRAM = 0x2 + SOCK_MAXADDRLEN = 0xff + SOCK_NONBLOCK = 0x20000000 + SOCK_RAW = 0x3 + SOCK_RDM = 0x4 + SOCK_SEQPACKET = 0x5 + SOCK_STREAM = 0x1 + SOL_LOCAL = 0x0 + SOL_SOCKET = 0xffff + SOMAXCONN = 0x80 + SO_ACCEPTCONN = 0x2 + SO_ACCEPTFILTER = 0x1000 + SO_BINTIME = 0x2000 + SO_BROADCAST = 0x20 + SO_DEBUG = 0x1 + SO_DOMAIN = 0x1019 + SO_DONTROUTE = 0x10 + SO_ERROR = 0x1007 + SO_KEEPALIVE = 0x8 + SO_LABEL = 0x1009 + SO_LINGER = 0x80 + SO_LISTENINCQLEN = 0x1013 + SO_LISTENQLEN = 0x1012 + SO_LISTENQLIMIT = 0x1011 + SO_MAX_PACING_RATE = 0x1018 + SO_NOSIGPIPE = 0x800 + SO_NO_DDP = 0x8000 + SO_NO_OFFLOAD = 0x4000 + SO_OOBINLINE = 0x100 + SO_PEERLABEL = 0x1010 + SO_PROTOCOL = 0x1016 + SO_PROTOTYPE = 0x1016 + SO_RCVBUF = 0x1002 + SO_RCVLOWAT = 0x1004 + SO_RCVTIMEO = 0x1006 + SO_RERROR = 0x20000 + SO_REUSEADDR = 0x4 + SO_REUSEPORT = 0x200 + SO_REUSEPORT_LB = 0x10000 + SO_SETFIB = 0x1014 + SO_SNDBUF = 0x1001 + SO_SNDLOWAT = 0x1003 + SO_SNDTIMEO = 0x1005 + SO_TIMESTAMP = 0x400 + SO_TS_BINTIME = 0x1 + SO_TS_CLOCK = 0x1017 + SO_TS_CLOCK_MAX = 0x3 + SO_TS_DEFAULT = 0x0 + SO_TS_MONOTONIC = 0x3 + SO_TS_REALTIME = 0x2 + SO_TS_REALTIME_MICRO = 0x0 + SO_TYPE = 0x1008 + SO_USELOOPBACK = 0x40 + SO_USER_COOKIE = 0x1015 + SO_VENDOR = 0x80000000 + S_BLKSIZE = 0x200 + S_IEXEC = 0x40 + S_IFBLK = 0x6000 + S_IFCHR = 0x2000 + S_IFDIR = 0x4000 + S_IFIFO = 0x1000 + S_IFLNK = 0xa000 + S_IFMT = 0xf000 + S_IFREG = 0x8000 + S_IFSOCK = 0xc000 + S_IFWHT = 0xe000 + S_IREAD = 0x100 + S_IRGRP = 0x20 + S_IROTH = 0x4 + S_IRUSR = 0x100 + S_IRWXG = 0x38 + S_IRWXO = 0x7 + S_IRWXU = 0x1c0 + S_ISGID = 0x400 + S_ISTXT = 0x200 + S_ISUID = 0x800 + S_ISVTX = 0x200 + S_IWGRP = 0x10 + S_IWOTH = 0x2 + S_IWRITE = 0x80 + S_IWUSR = 0x80 + S_IXGRP = 0x8 + S_IXOTH = 0x1 + S_IXUSR = 0x40 + TAB0 = 0x0 + TAB3 = 0x4 + TABDLY = 0x4 + TCIFLUSH = 0x1 + TCIOFF = 0x3 + TCIOFLUSH = 0x3 + TCION = 0x4 + TCOFLUSH = 0x2 + TCOOFF = 0x1 + TCOON = 0x2 + TCPOPT_EOL = 0x0 + TCPOPT_FAST_OPEN = 0x22 + TCPOPT_MAXSEG = 0x2 + TCPOPT_NOP = 0x1 + TCPOPT_PAD = 0x0 + TCPOPT_SACK = 0x5 + TCPOPT_SACK_PERMITTED = 0x4 + TCPOPT_SIGNATURE = 0x13 + TCPOPT_TIMESTAMP = 0x8 + TCPOPT_WINDOW = 0x3 + TCP_BBR_ACK_COMP_ALG = 0x448 + TCP_BBR_ALGORITHM = 0x43b + TCP_BBR_DRAIN_INC_EXTRA = 0x43c + TCP_BBR_DRAIN_PG = 0x42e + TCP_BBR_EXTRA_GAIN = 0x449 + TCP_BBR_EXTRA_STATE = 0x453 + TCP_BBR_FLOOR_MIN_TSO = 0x454 + TCP_BBR_HDWR_PACE = 0x451 + TCP_BBR_HOLD_TARGET = 0x436 + TCP_BBR_IWINTSO = 0x42b + TCP_BBR_LOWGAIN_FD = 0x436 + TCP_BBR_LOWGAIN_HALF = 0x435 + TCP_BBR_LOWGAIN_THRESH = 0x434 + TCP_BBR_MAX_RTO = 0x439 + TCP_BBR_MIN_RTO = 0x438 + TCP_BBR_MIN_TOPACEOUT = 0x455 + TCP_BBR_ONE_RETRAN = 0x431 + TCP_BBR_PACE_CROSS = 0x442 + TCP_BBR_PACE_DEL_TAR = 0x43f + TCP_BBR_PACE_OH = 0x435 + TCP_BBR_PACE_PER_SEC = 0x43e + TCP_BBR_PACE_SEG_MAX = 0x440 + TCP_BBR_PACE_SEG_MIN = 0x441 + TCP_BBR_POLICER_DETECT = 0x457 + TCP_BBR_PROBE_RTT_GAIN = 0x44d + TCP_BBR_PROBE_RTT_INT = 0x430 + TCP_BBR_PROBE_RTT_LEN = 0x44e + TCP_BBR_RACK_INIT_RATE = 0x458 + TCP_BBR_RACK_RTT_USE = 0x44a + TCP_BBR_RECFORCE = 0x42c + TCP_BBR_REC_OVER_HPTS = 0x43a + TCP_BBR_RETRAN_WTSO = 0x44b + TCP_BBR_RWND_IS_APP = 0x42f + TCP_BBR_SEND_IWND_IN_TSO = 0x44f + TCP_BBR_STARTUP_EXIT_EPOCH = 0x43d + TCP_BBR_STARTUP_LOSS_EXIT = 0x432 + TCP_BBR_STARTUP_PG = 0x42d + TCP_BBR_TMR_PACE_OH = 0x448 + TCP_BBR_TSLIMITS = 0x434 + TCP_BBR_TSTMP_RAISES = 0x456 + TCP_BBR_UNLIMITED = 0x43b + TCP_BBR_USEDEL_RATE = 0x437 + TCP_BBR_USE_LOWGAIN = 0x433 + TCP_BBR_USE_RACK_CHEAT = 0x450 + TCP_BBR_USE_RACK_RR = 0x450 + TCP_BBR_UTTER_MAX_TSO = 0x452 + TCP_CA_NAME_MAX = 0x10 + TCP_CCALGOOPT = 0x41 + TCP_CONGESTION = 0x40 + TCP_DATA_AFTER_CLOSE = 0x44c + TCP_DEFER_OPTIONS = 0x470 + TCP_DELACK = 0x48 + TCP_FASTOPEN = 0x401 + TCP_FASTOPEN_MAX_COOKIE_LEN = 0x10 + TCP_FASTOPEN_MIN_COOKIE_LEN = 0x4 + TCP_FASTOPEN_PSK_LEN = 0x10 + TCP_FAST_RSM_HACK = 0x471 + TCP_FIN_IS_RST = 0x49 + TCP_FUNCTION_BLK = 0x2000 + TCP_FUNCTION_NAME_LEN_MAX = 0x20 + TCP_HDWR_RATE_CAP = 0x46a + TCP_HDWR_UP_ONLY = 0x46c + TCP_IDLE_REDUCE = 0x46 + TCP_INFO = 0x20 + TCP_IWND_NB = 0x2b + TCP_IWND_NSEG = 0x2c + TCP_KEEPCNT = 0x400 + TCP_KEEPIDLE = 0x100 + TCP_KEEPINIT = 0x80 + TCP_KEEPINTVL = 0x200 + TCP_LOG = 0x22 + TCP_LOGBUF = 0x23 + TCP_LOGDUMP = 0x25 + TCP_LOGDUMPID = 0x26 + TCP_LOGID = 0x24 + TCP_LOGID_CNT = 0x2e + TCP_LOG_ID_LEN = 0x40 + TCP_LOG_LIMIT = 0x4a + TCP_LOG_TAG = 0x2f + TCP_MAXBURST = 0x4 + TCP_MAXHLEN = 0x3c + TCP_MAXOLEN = 0x28 + TCP_MAXPEAKRATE = 0x45 + TCP_MAXSEG = 0x2 + TCP_MAXUNACKTIME = 0x44 + TCP_MAXWIN = 0xffff + TCP_MAX_SACK = 0x4 + TCP_MAX_WINSHIFT = 0xe + TCP_MD5SIG = 0x10 + TCP_MINMSS = 0xd8 + TCP_MSS = 0x218 + TCP_NODELAY = 0x1 + TCP_NOOPT = 0x8 + TCP_NOPUSH = 0x4 + TCP_NO_PRR = 0x462 + TCP_PACING_RATE_CAP = 0x46b + TCP_PCAP_IN = 0x1000 + TCP_PCAP_OUT = 0x800 + TCP_PERF_INFO = 0x4e + TCP_PROC_ACCOUNTING = 0x4c + TCP_RACK_ABC_VAL = 0x46d + TCP_RACK_CHEAT_NOT_CONF_RATE = 0x459 + TCP_RACK_DO_DETECTION = 0x449 + TCP_RACK_EARLY_RECOV = 0x423 + TCP_RACK_EARLY_SEG = 0x424 + TCP_RACK_FORCE_MSEG = 0x45d + TCP_RACK_GP_INCREASE = 0x446 + TCP_RACK_GP_INCREASE_CA = 0x45a + TCP_RACK_GP_INCREASE_REC = 0x45c + TCP_RACK_GP_INCREASE_SS = 0x45b + TCP_RACK_IDLE_REDUCE_HIGH = 0x444 + TCP_RACK_MBUF_QUEUE = 0x41a + TCP_RACK_MEASURE_CNT = 0x46f + TCP_RACK_MIN_PACE = 0x445 + TCP_RACK_MIN_PACE_SEG = 0x446 + TCP_RACK_MIN_TO = 0x422 + TCP_RACK_NONRXT_CFG_RATE = 0x463 + TCP_RACK_NO_PUSH_AT_MAX = 0x466 + TCP_RACK_PACE_ALWAYS = 0x41f + TCP_RACK_PACE_MAX_SEG = 0x41e + TCP_RACK_PACE_RATE_CA = 0x45e + TCP_RACK_PACE_RATE_REC = 0x460 + TCP_RACK_PACE_RATE_SS = 0x45f + TCP_RACK_PACE_REDUCE = 0x41d + TCP_RACK_PACE_TO_FILL = 0x467 + TCP_RACK_PACING_BETA = 0x472 + TCP_RACK_PACING_BETA_ECN = 0x473 + TCP_RACK_PKT_DELAY = 0x428 + TCP_RACK_PROFILE = 0x469 + TCP_RACK_PROP = 0x41b + TCP_RACK_PROP_RATE = 0x420 + TCP_RACK_PRR_SENDALOT = 0x421 + TCP_RACK_REORD_FADE = 0x426 + TCP_RACK_REORD_THRESH = 0x425 + TCP_RACK_RR_CONF = 0x459 + TCP_RACK_TIMER_SLOP = 0x474 + TCP_RACK_TLP_INC_VAR = 0x429 + TCP_RACK_TLP_REDUCE = 0x41c + TCP_RACK_TLP_THRESH = 0x427 + TCP_RACK_TLP_USE = 0x447 + TCP_REC_ABC_VAL = 0x46e + TCP_REMOTE_UDP_ENCAPS_PORT = 0x47 + TCP_REUSPORT_LB_NUMA = 0x402 + TCP_REUSPORT_LB_NUMA_CURDOM = -0x1 + TCP_REUSPORT_LB_NUMA_NODOM = -0x2 + TCP_RXTLS_ENABLE = 0x29 + TCP_RXTLS_MODE = 0x2a + TCP_SHARED_CWND_ALLOWED = 0x4b + TCP_SHARED_CWND_ENABLE = 0x464 + TCP_SHARED_CWND_TIME_LIMIT = 0x468 + TCP_STATS = 0x21 + TCP_TIMELY_DYN_ADJ = 0x465 + TCP_TLS_MODE_IFNET = 0x2 + TCP_TLS_MODE_NONE = 0x0 + TCP_TLS_MODE_SW = 0x1 + TCP_TLS_MODE_TOE = 0x3 + TCP_TXTLS_ENABLE = 0x27 + TCP_TXTLS_MODE = 0x28 + TCP_USER_LOG = 0x30 + TCP_USE_CMP_ACKS = 0x4d + TCP_VENDOR = 0x80000000 + TCSAFLUSH = 0x2 + TIMER_ABSTIME = 0x1 + TIMER_RELTIME = 0x0 + TIOCCBRK = 0x2000747a + TIOCCDTR = 0x20007478 + TIOCCONS = 0x80047462 + TIOCDRAIN = 0x2000745e + TIOCEXCL = 0x2000740d + TIOCEXT = 0x80047460 + TIOCFLUSH = 0x80047410 + TIOCGDRAINWAIT = 0x40047456 + TIOCGETA = 0x402c7413 + TIOCGETD = 0x4004741a + TIOCGPGRP = 0x40047477 + TIOCGPTN = 0x4004740f + TIOCGSID = 0x40047463 + TIOCGWINSZ = 0x40087468 + TIOCMBIC = 0x8004746b + TIOCMBIS = 0x8004746c + TIOCMGDTRWAIT = 0x4004745a + TIOCMGET = 0x4004746a + TIOCMSDTRWAIT = 0x8004745b + TIOCMSET = 0x8004746d + TIOCM_CAR = 0x40 + TIOCM_CD = 0x40 + TIOCM_CTS = 0x20 + TIOCM_DCD = 0x40 + TIOCM_DSR = 0x100 + TIOCM_DTR = 0x2 + TIOCM_LE = 0x1 + TIOCM_RI = 0x80 + TIOCM_RNG = 0x80 + TIOCM_RTS = 0x4 + TIOCM_SR = 0x10 + TIOCM_ST = 0x8 + TIOCNOTTY = 0x20007471 + TIOCNXCL = 0x2000740e + TIOCOUTQ = 0x40047473 + TIOCPKT = 0x80047470 + TIOCPKT_DATA = 0x0 + TIOCPKT_DOSTOP = 0x20 + TIOCPKT_FLUSHREAD = 0x1 + TIOCPKT_FLUSHWRITE = 0x2 + TIOCPKT_IOCTL = 0x40 + TIOCPKT_NOSTOP = 0x10 + TIOCPKT_START = 0x8 + TIOCPKT_STOP = 0x4 + TIOCPTMASTER = 0x2000741c + TIOCSBRK = 0x2000747b + TIOCSCTTY = 0x20007461 + TIOCSDRAINWAIT = 0x80047457 + TIOCSDTR = 0x20007479 + TIOCSETA = 0x802c7414 + TIOCSETAF = 0x802c7416 + TIOCSETAW = 0x802c7415 + TIOCSETD = 0x8004741b + TIOCSIG = 0x2004745f + TIOCSPGRP = 0x80047476 + TIOCSTART = 0x2000746e + TIOCSTAT = 0x20007465 + TIOCSTI = 0x80017472 + TIOCSTOP = 0x2000746f + TIOCSWINSZ = 0x80087467 + TIOCTIMESTAMP = 0x40107459 + TIOCUCNTL = 0x80047466 + TOSTOP = 0x400000 + UTIME_NOW = -0x1 + UTIME_OMIT = -0x2 + VDISCARD = 0xf + VDSUSP = 0xb + VEOF = 0x0 + VEOL = 0x1 + VEOL2 = 0x2 + VERASE = 0x3 + VERASE2 = 0x7 + VINTR = 0x8 + VKILL = 0x5 + VLNEXT = 0xe + VMIN = 0x10 + VQUIT = 0x9 + VREPRINT = 0x6 + VSTART = 0xc + VSTATUS = 0x12 + VSTOP = 0xd + VSUSP = 0xa + VTIME = 0x11 + VWERASE = 0x4 + WCONTINUED = 0x4 + WCOREFLAG = 0x80 + WEXITED = 0x10 + WLINUXCLONE = 0x80000000 + WNOHANG = 0x1 + WNOWAIT = 0x8 + WSTOPPED = 0x2 + WTRAPPED = 0x20 + WUNTRACED = 0x2 +) + +// Errors +const ( + E2BIG = syscall.Errno(0x7) + EACCES = syscall.Errno(0xd) + EADDRINUSE = syscall.Errno(0x30) + EADDRNOTAVAIL = syscall.Errno(0x31) + EAFNOSUPPORT = syscall.Errno(0x2f) + EAGAIN = syscall.Errno(0x23) + EALREADY = syscall.Errno(0x25) + EAUTH = syscall.Errno(0x50) + EBADF = syscall.Errno(0x9) + EBADMSG = syscall.Errno(0x59) + EBADRPC = syscall.Errno(0x48) + EBUSY = syscall.Errno(0x10) + ECANCELED = syscall.Errno(0x55) + ECAPMODE = syscall.Errno(0x5e) + ECHILD = syscall.Errno(0xa) + ECONNABORTED = syscall.Errno(0x35) + ECONNREFUSED = syscall.Errno(0x3d) + ECONNRESET = syscall.Errno(0x36) + EDEADLK = syscall.Errno(0xb) + EDESTADDRREQ = syscall.Errno(0x27) + EDOM = syscall.Errno(0x21) + EDOOFUS = syscall.Errno(0x58) + EDQUOT = syscall.Errno(0x45) + EEXIST = syscall.Errno(0x11) + EFAULT = syscall.Errno(0xe) + EFBIG = syscall.Errno(0x1b) + EFTYPE = syscall.Errno(0x4f) + EHOSTDOWN = syscall.Errno(0x40) + EHOSTUNREACH = syscall.Errno(0x41) + EIDRM = syscall.Errno(0x52) + EILSEQ = syscall.Errno(0x56) + EINPROGRESS = syscall.Errno(0x24) + EINTEGRITY = syscall.Errno(0x61) + EINTR = syscall.Errno(0x4) + EINVAL = syscall.Errno(0x16) + EIO = syscall.Errno(0x5) + EISCONN = syscall.Errno(0x38) + EISDIR = syscall.Errno(0x15) + ELAST = syscall.Errno(0x61) + ELOOP = syscall.Errno(0x3e) + EMFILE = syscall.Errno(0x18) + EMLINK = syscall.Errno(0x1f) + EMSGSIZE = syscall.Errno(0x28) + EMULTIHOP = syscall.Errno(0x5a) + ENAMETOOLONG = syscall.Errno(0x3f) + ENEEDAUTH = syscall.Errno(0x51) + ENETDOWN = syscall.Errno(0x32) + ENETRESET = syscall.Errno(0x34) + ENETUNREACH = syscall.Errno(0x33) + ENFILE = syscall.Errno(0x17) + ENOATTR = syscall.Errno(0x57) + ENOBUFS = syscall.Errno(0x37) + ENODEV = syscall.Errno(0x13) + ENOENT = syscall.Errno(0x2) + ENOEXEC = syscall.Errno(0x8) + ENOLCK = syscall.Errno(0x4d) + ENOLINK = syscall.Errno(0x5b) + ENOMEM = syscall.Errno(0xc) + ENOMSG = syscall.Errno(0x53) + ENOPROTOOPT = syscall.Errno(0x2a) + ENOSPC = syscall.Errno(0x1c) + ENOSYS = syscall.Errno(0x4e) + ENOTBLK = syscall.Errno(0xf) + ENOTCAPABLE = syscall.Errno(0x5d) + ENOTCONN = syscall.Errno(0x39) + ENOTDIR = syscall.Errno(0x14) + ENOTEMPTY = syscall.Errno(0x42) + ENOTRECOVERABLE = syscall.Errno(0x5f) + ENOTSOCK = syscall.Errno(0x26) + ENOTSUP = syscall.Errno(0x2d) + ENOTTY = syscall.Errno(0x19) + ENXIO = syscall.Errno(0x6) + EOPNOTSUPP = syscall.Errno(0x2d) + EOVERFLOW = syscall.Errno(0x54) + EOWNERDEAD = syscall.Errno(0x60) + EPERM = syscall.Errno(0x1) + EPFNOSUPPORT = syscall.Errno(0x2e) + EPIPE = syscall.Errno(0x20) + EPROCLIM = syscall.Errno(0x43) + EPROCUNAVAIL = syscall.Errno(0x4c) + EPROGMISMATCH = syscall.Errno(0x4b) + EPROGUNAVAIL = syscall.Errno(0x4a) + EPROTO = syscall.Errno(0x5c) + EPROTONOSUPPORT = syscall.Errno(0x2b) + EPROTOTYPE = syscall.Errno(0x29) + ERANGE = syscall.Errno(0x22) + EREMOTE = syscall.Errno(0x47) + EROFS = syscall.Errno(0x1e) + ERPCMISMATCH = syscall.Errno(0x49) + ESHUTDOWN = syscall.Errno(0x3a) + ESOCKTNOSUPPORT = syscall.Errno(0x2c) + ESPIPE = syscall.Errno(0x1d) + ESRCH = syscall.Errno(0x3) + ESTALE = syscall.Errno(0x46) + ETIMEDOUT = syscall.Errno(0x3c) + ETOOMANYREFS = syscall.Errno(0x3b) + ETXTBSY = syscall.Errno(0x1a) + EUSERS = syscall.Errno(0x44) + EWOULDBLOCK = syscall.Errno(0x23) + EXDEV = syscall.Errno(0x12) +) + +// Signals +const ( + SIGABRT = syscall.Signal(0x6) + SIGALRM = syscall.Signal(0xe) + SIGBUS = syscall.Signal(0xa) + SIGCHLD = syscall.Signal(0x14) + SIGCONT = syscall.Signal(0x13) + SIGEMT = syscall.Signal(0x7) + SIGFPE = syscall.Signal(0x8) + SIGHUP = syscall.Signal(0x1) + SIGILL = syscall.Signal(0x4) + SIGINFO = syscall.Signal(0x1d) + SIGINT = syscall.Signal(0x2) + SIGIO = syscall.Signal(0x17) + SIGIOT = syscall.Signal(0x6) + SIGKILL = syscall.Signal(0x9) + SIGLIBRT = syscall.Signal(0x21) + SIGLWP = syscall.Signal(0x20) + SIGPIPE = syscall.Signal(0xd) + SIGPROF = syscall.Signal(0x1b) + SIGQUIT = syscall.Signal(0x3) + SIGSEGV = syscall.Signal(0xb) + SIGSTOP = syscall.Signal(0x11) + SIGSYS = syscall.Signal(0xc) + SIGTERM = syscall.Signal(0xf) + SIGTHR = syscall.Signal(0x20) + SIGTRAP = syscall.Signal(0x5) + SIGTSTP = syscall.Signal(0x12) + SIGTTIN = syscall.Signal(0x15) + SIGTTOU = syscall.Signal(0x16) + SIGURG = syscall.Signal(0x10) + SIGUSR1 = syscall.Signal(0x1e) + SIGUSR2 = syscall.Signal(0x1f) + SIGVTALRM = syscall.Signal(0x1a) + SIGWINCH = syscall.Signal(0x1c) + SIGXCPU = syscall.Signal(0x18) + SIGXFSZ = syscall.Signal(0x19) +) + +// Error table +var errorList = [...]struct { + num syscall.Errno + name string + desc string +}{ + {1, "EPERM", "operation not permitted"}, + {2, "ENOENT", "no such file or directory"}, + {3, "ESRCH", "no such process"}, + {4, "EINTR", "interrupted system call"}, + {5, "EIO", "input/output error"}, + {6, "ENXIO", "device not configured"}, + {7, "E2BIG", "argument list too long"}, + {8, "ENOEXEC", "exec format error"}, + {9, "EBADF", "bad file descriptor"}, + {10, "ECHILD", "no child processes"}, + {11, "EDEADLK", "resource deadlock avoided"}, + {12, "ENOMEM", "cannot allocate memory"}, + {13, "EACCES", "permission denied"}, + {14, "EFAULT", "bad address"}, + {15, "ENOTBLK", "block device required"}, + {16, "EBUSY", "device busy"}, + {17, "EEXIST", "file exists"}, + {18, "EXDEV", "cross-device link"}, + {19, "ENODEV", "operation not supported by device"}, + {20, "ENOTDIR", "not a directory"}, + {21, "EISDIR", "is a directory"}, + {22, "EINVAL", "invalid argument"}, + {23, "ENFILE", "too many open files in system"}, + {24, "EMFILE", "too many open files"}, + {25, "ENOTTY", "inappropriate ioctl for device"}, + {26, "ETXTBSY", "text file busy"}, + {27, "EFBIG", "file too large"}, + {28, "ENOSPC", "no space left on device"}, + {29, "ESPIPE", "illegal seek"}, + {30, "EROFS", "read-only file system"}, + {31, "EMLINK", "too many links"}, + {32, "EPIPE", "broken pipe"}, + {33, "EDOM", "numerical argument out of domain"}, + {34, "ERANGE", "result too large"}, + {35, "EWOULDBLOCK", "resource temporarily unavailable"}, + {36, "EINPROGRESS", "operation now in progress"}, + {37, "EALREADY", "operation already in progress"}, + {38, "ENOTSOCK", "socket operation on non-socket"}, + {39, "EDESTADDRREQ", "destination address required"}, + {40, "EMSGSIZE", "message too long"}, + {41, "EPROTOTYPE", "protocol wrong type for socket"}, + {42, "ENOPROTOOPT", "protocol not available"}, + {43, "EPROTONOSUPPORT", "protocol not supported"}, + {44, "ESOCKTNOSUPPORT", "socket type not supported"}, + {45, "EOPNOTSUPP", "operation not supported"}, + {46, "EPFNOSUPPORT", "protocol family not supported"}, + {47, "EAFNOSUPPORT", "address family not supported by protocol family"}, + {48, "EADDRINUSE", "address already in use"}, + {49, "EADDRNOTAVAIL", "can't assign requested address"}, + {50, "ENETDOWN", "network is down"}, + {51, "ENETUNREACH", "network is unreachable"}, + {52, "ENETRESET", "network dropped connection on reset"}, + {53, "ECONNABORTED", "software caused connection abort"}, + {54, "ECONNRESET", "connection reset by peer"}, + {55, "ENOBUFS", "no buffer space available"}, + {56, "EISCONN", "socket is already connected"}, + {57, "ENOTCONN", "socket is not connected"}, + {58, "ESHUTDOWN", "can't send after socket shutdown"}, + {59, "ETOOMANYREFS", "too many references: can't splice"}, + {60, "ETIMEDOUT", "operation timed out"}, + {61, "ECONNREFUSED", "connection refused"}, + {62, "ELOOP", "too many levels of symbolic links"}, + {63, "ENAMETOOLONG", "file name too long"}, + {64, "EHOSTDOWN", "host is down"}, + {65, "EHOSTUNREACH", "no route to host"}, + {66, "ENOTEMPTY", "directory not empty"}, + {67, "EPROCLIM", "too many processes"}, + {68, "EUSERS", "too many users"}, + {69, "EDQUOT", "disc quota exceeded"}, + {70, "ESTALE", "stale NFS file handle"}, + {71, "EREMOTE", "too many levels of remote in path"}, + {72, "EBADRPC", "RPC struct is bad"}, + {73, "ERPCMISMATCH", "RPC version wrong"}, + {74, "EPROGUNAVAIL", "RPC prog. not avail"}, + {75, "EPROGMISMATCH", "program version wrong"}, + {76, "EPROCUNAVAIL", "bad procedure for program"}, + {77, "ENOLCK", "no locks available"}, + {78, "ENOSYS", "function not implemented"}, + {79, "EFTYPE", "inappropriate file type or format"}, + {80, "EAUTH", "authentication error"}, + {81, "ENEEDAUTH", "need authenticator"}, + {82, "EIDRM", "identifier removed"}, + {83, "ENOMSG", "no message of desired type"}, + {84, "EOVERFLOW", "value too large to be stored in data type"}, + {85, "ECANCELED", "operation canceled"}, + {86, "EILSEQ", "illegal byte sequence"}, + {87, "ENOATTR", "attribute not found"}, + {88, "EDOOFUS", "programming error"}, + {89, "EBADMSG", "bad message"}, + {90, "EMULTIHOP", "multihop attempted"}, + {91, "ENOLINK", "link has been severed"}, + {92, "EPROTO", "protocol error"}, + {93, "ENOTCAPABLE", "capabilities insufficient"}, + {94, "ECAPMODE", "not permitted in capability mode"}, + {95, "ENOTRECOVERABLE", "state not recoverable"}, + {96, "EOWNERDEAD", "previous owner died"}, + {97, "EINTEGRITY", "integrity check failed"}, +} + +// Signal table +var signalList = [...]struct { + num syscall.Signal + name string + desc string +}{ + {1, "SIGHUP", "hangup"}, + {2, "SIGINT", "interrupt"}, + {3, "SIGQUIT", "quit"}, + {4, "SIGILL", "illegal instruction"}, + {5, "SIGTRAP", "trace/BPT trap"}, + {6, "SIGIOT", "abort trap"}, + {7, "SIGEMT", "EMT trap"}, + {8, "SIGFPE", "floating point exception"}, + {9, "SIGKILL", "killed"}, + {10, "SIGBUS", "bus error"}, + {11, "SIGSEGV", "segmentation fault"}, + {12, "SIGSYS", "bad system call"}, + {13, "SIGPIPE", "broken pipe"}, + {14, "SIGALRM", "alarm clock"}, + {15, "SIGTERM", "terminated"}, + {16, "SIGURG", "urgent I/O condition"}, + {17, "SIGSTOP", "suspended (signal)"}, + {18, "SIGTSTP", "suspended"}, + {19, "SIGCONT", "continued"}, + {20, "SIGCHLD", "child exited"}, + {21, "SIGTTIN", "stopped (tty input)"}, + {22, "SIGTTOU", "stopped (tty output)"}, + {23, "SIGIO", "I/O possible"}, + {24, "SIGXCPU", "cputime limit exceeded"}, + {25, "SIGXFSZ", "filesize limit exceeded"}, + {26, "SIGVTALRM", "virtual timer expired"}, + {27, "SIGPROF", "profiling timer expired"}, + {28, "SIGWINCH", "window size changes"}, + {29, "SIGINFO", "information request"}, + {30, "SIGUSR1", "user defined signal 1"}, + {31, "SIGUSR2", "user defined signal 2"}, + {32, "SIGTHR", "unknown signal"}, + {33, "SIGLIBRT", "unknown signal"}, +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index bcc45d10..785d693e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -38,7 +38,8 @@ const ( AF_KEY = 0xf AF_LLC = 0x1a AF_LOCAL = 0x1 - AF_MAX = 0x2d + AF_MAX = 0x2e + AF_MCTP = 0x2d AF_MPLS = 0x1c AF_NETBEUI = 0xd AF_NETLINK = 0x10 @@ -139,6 +140,306 @@ const ( ARPHRD_VOID = 0xffff ARPHRD_VSOCKMON = 0x33a ARPHRD_X25 = 0x10f + AUDIT_ADD = 0x3eb + AUDIT_ADD_RULE = 0x3f3 + AUDIT_ALWAYS = 0x2 + AUDIT_ANOM_ABEND = 0x6a5 + AUDIT_ANOM_CREAT = 0x6a7 + AUDIT_ANOM_LINK = 0x6a6 + AUDIT_ANOM_PROMISCUOUS = 0x6a4 + AUDIT_ARCH = 0xb + AUDIT_ARCH_AARCH64 = 0xc00000b7 + AUDIT_ARCH_ALPHA = 0xc0009026 + AUDIT_ARCH_ARCOMPACT = 0x4000005d + AUDIT_ARCH_ARCOMPACTBE = 0x5d + AUDIT_ARCH_ARCV2 = 0x400000c3 + AUDIT_ARCH_ARCV2BE = 0xc3 + AUDIT_ARCH_ARM = 0x40000028 + AUDIT_ARCH_ARMEB = 0x28 + AUDIT_ARCH_C6X = 0x4000008c + AUDIT_ARCH_C6XBE = 0x8c + AUDIT_ARCH_CRIS = 0x4000004c + AUDIT_ARCH_CSKY = 0x400000fc + AUDIT_ARCH_FRV = 0x5441 + AUDIT_ARCH_H8300 = 0x2e + AUDIT_ARCH_HEXAGON = 0xa4 + AUDIT_ARCH_I386 = 0x40000003 + AUDIT_ARCH_IA64 = 0xc0000032 + AUDIT_ARCH_LOONGARCH32 = 0x40000102 + AUDIT_ARCH_LOONGARCH64 = 0xc0000102 + AUDIT_ARCH_M32R = 0x58 + AUDIT_ARCH_M68K = 0x4 + AUDIT_ARCH_MICROBLAZE = 0xbd + AUDIT_ARCH_MIPS = 0x8 + AUDIT_ARCH_MIPS64 = 0x80000008 + AUDIT_ARCH_MIPS64N32 = 0xa0000008 + AUDIT_ARCH_MIPSEL = 0x40000008 + AUDIT_ARCH_MIPSEL64 = 0xc0000008 + AUDIT_ARCH_MIPSEL64N32 = 0xe0000008 + AUDIT_ARCH_NDS32 = 0x400000a7 + AUDIT_ARCH_NDS32BE = 0xa7 + AUDIT_ARCH_NIOS2 = 0x40000071 + AUDIT_ARCH_OPENRISC = 0x5c + AUDIT_ARCH_PARISC = 0xf + AUDIT_ARCH_PARISC64 = 0x8000000f + AUDIT_ARCH_PPC = 0x14 + AUDIT_ARCH_PPC64 = 0x80000015 + AUDIT_ARCH_PPC64LE = 0xc0000015 + AUDIT_ARCH_RISCV32 = 0x400000f3 + AUDIT_ARCH_RISCV64 = 0xc00000f3 + AUDIT_ARCH_S390 = 0x16 + AUDIT_ARCH_S390X = 0x80000016 + AUDIT_ARCH_SH = 0x2a + AUDIT_ARCH_SH64 = 0x8000002a + AUDIT_ARCH_SHEL = 0x4000002a + AUDIT_ARCH_SHEL64 = 0xc000002a + AUDIT_ARCH_SPARC = 0x2 + AUDIT_ARCH_SPARC64 = 0x8000002b + AUDIT_ARCH_TILEGX = 0xc00000bf + AUDIT_ARCH_TILEGX32 = 0x400000bf + AUDIT_ARCH_TILEPRO = 0x400000bc + AUDIT_ARCH_UNICORE = 0x4000006e + AUDIT_ARCH_X86_64 = 0xc000003e + AUDIT_ARCH_XTENSA = 0x5e + AUDIT_ARG0 = 0xc8 + AUDIT_ARG1 = 0xc9 + AUDIT_ARG2 = 0xca + AUDIT_ARG3 = 0xcb + AUDIT_AVC = 0x578 + AUDIT_AVC_PATH = 0x57a + AUDIT_BITMASK_SIZE = 0x40 + AUDIT_BIT_MASK = 0x8000000 + AUDIT_BIT_TEST = 0x48000000 + AUDIT_BPF = 0x536 + AUDIT_BPRM_FCAPS = 0x529 + AUDIT_CAPSET = 0x52a + AUDIT_CLASS_CHATTR = 0x2 + AUDIT_CLASS_CHATTR_32 = 0x3 + AUDIT_CLASS_DIR_WRITE = 0x0 + AUDIT_CLASS_DIR_WRITE_32 = 0x1 + AUDIT_CLASS_READ = 0x4 + AUDIT_CLASS_READ_32 = 0x5 + AUDIT_CLASS_SIGNAL = 0x8 + AUDIT_CLASS_SIGNAL_32 = 0x9 + AUDIT_CLASS_WRITE = 0x6 + AUDIT_CLASS_WRITE_32 = 0x7 + AUDIT_COMPARE_AUID_TO_EUID = 0x10 + AUDIT_COMPARE_AUID_TO_FSUID = 0xe + AUDIT_COMPARE_AUID_TO_OBJ_UID = 0x5 + AUDIT_COMPARE_AUID_TO_SUID = 0xf + AUDIT_COMPARE_EGID_TO_FSGID = 0x17 + AUDIT_COMPARE_EGID_TO_OBJ_GID = 0x4 + AUDIT_COMPARE_EGID_TO_SGID = 0x18 + AUDIT_COMPARE_EUID_TO_FSUID = 0x12 + AUDIT_COMPARE_EUID_TO_OBJ_UID = 0x3 + AUDIT_COMPARE_EUID_TO_SUID = 0x11 + AUDIT_COMPARE_FSGID_TO_OBJ_GID = 0x9 + AUDIT_COMPARE_FSUID_TO_OBJ_UID = 0x8 + AUDIT_COMPARE_GID_TO_EGID = 0x14 + AUDIT_COMPARE_GID_TO_FSGID = 0x15 + AUDIT_COMPARE_GID_TO_OBJ_GID = 0x2 + AUDIT_COMPARE_GID_TO_SGID = 0x16 + AUDIT_COMPARE_SGID_TO_FSGID = 0x19 + AUDIT_COMPARE_SGID_TO_OBJ_GID = 0x7 + AUDIT_COMPARE_SUID_TO_FSUID = 0x13 + AUDIT_COMPARE_SUID_TO_OBJ_UID = 0x6 + AUDIT_COMPARE_UID_TO_AUID = 0xa + AUDIT_COMPARE_UID_TO_EUID = 0xb + AUDIT_COMPARE_UID_TO_FSUID = 0xc + AUDIT_COMPARE_UID_TO_OBJ_UID = 0x1 + AUDIT_COMPARE_UID_TO_SUID = 0xd + AUDIT_CONFIG_CHANGE = 0x519 + AUDIT_CWD = 0x51b + AUDIT_DAEMON_ABORT = 0x4b2 + AUDIT_DAEMON_CONFIG = 0x4b3 + AUDIT_DAEMON_END = 0x4b1 + AUDIT_DAEMON_START = 0x4b0 + AUDIT_DEL = 0x3ec + AUDIT_DEL_RULE = 0x3f4 + AUDIT_DEVMAJOR = 0x64 + AUDIT_DEVMINOR = 0x65 + AUDIT_DIR = 0x6b + AUDIT_DM_CTRL = 0x53a + AUDIT_DM_EVENT = 0x53b + AUDIT_EGID = 0x6 + AUDIT_EOE = 0x528 + AUDIT_EQUAL = 0x40000000 + AUDIT_EUID = 0x2 + AUDIT_EVENT_LISTENER = 0x537 + AUDIT_EXE = 0x70 + AUDIT_EXECVE = 0x51d + AUDIT_EXIT = 0x67 + AUDIT_FAIL_PANIC = 0x2 + AUDIT_FAIL_PRINTK = 0x1 + AUDIT_FAIL_SILENT = 0x0 + AUDIT_FANOTIFY = 0x533 + AUDIT_FD_PAIR = 0x525 + AUDIT_FEATURE_BITMAP_ALL = 0x7f + AUDIT_FEATURE_BITMAP_BACKLOG_LIMIT = 0x1 + AUDIT_FEATURE_BITMAP_BACKLOG_WAIT_TIME = 0x2 + AUDIT_FEATURE_BITMAP_EXCLUDE_EXTEND = 0x8 + AUDIT_FEATURE_BITMAP_EXECUTABLE_PATH = 0x4 + AUDIT_FEATURE_BITMAP_FILTER_FS = 0x40 + AUDIT_FEATURE_BITMAP_LOST_RESET = 0x20 + AUDIT_FEATURE_BITMAP_SESSIONID_FILTER = 0x10 + AUDIT_FEATURE_CHANGE = 0x530 + AUDIT_FEATURE_LOGINUID_IMMUTABLE = 0x1 + AUDIT_FEATURE_ONLY_UNSET_LOGINUID = 0x0 + AUDIT_FEATURE_VERSION = 0x1 + AUDIT_FIELD_COMPARE = 0x6f + AUDIT_FILETYPE = 0x6c + AUDIT_FILTERKEY = 0xd2 + AUDIT_FILTER_ENTRY = 0x2 + AUDIT_FILTER_EXCLUDE = 0x5 + AUDIT_FILTER_EXIT = 0x4 + AUDIT_FILTER_FS = 0x6 + AUDIT_FILTER_PREPEND = 0x10 + AUDIT_FILTER_TASK = 0x1 + AUDIT_FILTER_TYPE = 0x5 + AUDIT_FILTER_URING_EXIT = 0x7 + AUDIT_FILTER_USER = 0x0 + AUDIT_FILTER_WATCH = 0x3 + AUDIT_FIRST_KERN_ANOM_MSG = 0x6a4 + AUDIT_FIRST_USER_MSG = 0x44c + AUDIT_FIRST_USER_MSG2 = 0x834 + AUDIT_FSGID = 0x8 + AUDIT_FSTYPE = 0x1a + AUDIT_FSUID = 0x4 + AUDIT_GET = 0x3e8 + AUDIT_GET_FEATURE = 0x3fb + AUDIT_GID = 0x5 + AUDIT_GREATER_THAN = 0x20000000 + AUDIT_GREATER_THAN_OR_EQUAL = 0x60000000 + AUDIT_INODE = 0x66 + AUDIT_INTEGRITY_DATA = 0x708 + AUDIT_INTEGRITY_EVM_XATTR = 0x70e + AUDIT_INTEGRITY_HASH = 0x70b + AUDIT_INTEGRITY_METADATA = 0x709 + AUDIT_INTEGRITY_PCR = 0x70c + AUDIT_INTEGRITY_POLICY_RULE = 0x70f + AUDIT_INTEGRITY_RULE = 0x70d + AUDIT_INTEGRITY_STATUS = 0x70a + AUDIT_IPC = 0x517 + AUDIT_IPC_SET_PERM = 0x51f + AUDIT_KERNEL = 0x7d0 + AUDIT_KERNEL_OTHER = 0x524 + AUDIT_KERN_MODULE = 0x532 + AUDIT_LAST_FEATURE = 0x1 + AUDIT_LAST_KERN_ANOM_MSG = 0x707 + AUDIT_LAST_USER_MSG = 0x4af + AUDIT_LAST_USER_MSG2 = 0xbb7 + AUDIT_LESS_THAN = 0x10000000 + AUDIT_LESS_THAN_OR_EQUAL = 0x50000000 + AUDIT_LIST = 0x3ea + AUDIT_LIST_RULES = 0x3f5 + AUDIT_LOGIN = 0x3ee + AUDIT_LOGINUID = 0x9 + AUDIT_LOGINUID_SET = 0x18 + AUDIT_MAC_CALIPSO_ADD = 0x58a + AUDIT_MAC_CALIPSO_DEL = 0x58b + AUDIT_MAC_CIPSOV4_ADD = 0x57f + AUDIT_MAC_CIPSOV4_DEL = 0x580 + AUDIT_MAC_CONFIG_CHANGE = 0x57d + AUDIT_MAC_IPSEC_ADDSA = 0x583 + AUDIT_MAC_IPSEC_ADDSPD = 0x585 + AUDIT_MAC_IPSEC_DELSA = 0x584 + AUDIT_MAC_IPSEC_DELSPD = 0x586 + AUDIT_MAC_IPSEC_EVENT = 0x587 + AUDIT_MAC_MAP_ADD = 0x581 + AUDIT_MAC_MAP_DEL = 0x582 + AUDIT_MAC_POLICY_LOAD = 0x57b + AUDIT_MAC_STATUS = 0x57c + AUDIT_MAC_UNLBL_ALLOW = 0x57e + AUDIT_MAC_UNLBL_STCADD = 0x588 + AUDIT_MAC_UNLBL_STCDEL = 0x589 + AUDIT_MAKE_EQUIV = 0x3f7 + AUDIT_MAX_FIELDS = 0x40 + AUDIT_MAX_FIELD_COMPARE = 0x19 + AUDIT_MAX_KEY_LEN = 0x100 + AUDIT_MESSAGE_TEXT_MAX = 0x2170 + AUDIT_MMAP = 0x52b + AUDIT_MQ_GETSETATTR = 0x523 + AUDIT_MQ_NOTIFY = 0x522 + AUDIT_MQ_OPEN = 0x520 + AUDIT_MQ_SENDRECV = 0x521 + AUDIT_MSGTYPE = 0xc + AUDIT_NEGATE = 0x80000000 + AUDIT_NETFILTER_CFG = 0x52d + AUDIT_NETFILTER_PKT = 0x52c + AUDIT_NEVER = 0x0 + AUDIT_NLGRP_MAX = 0x1 + AUDIT_NOT_EQUAL = 0x30000000 + AUDIT_NR_FILTERS = 0x8 + AUDIT_OBJ_GID = 0x6e + AUDIT_OBJ_LEV_HIGH = 0x17 + AUDIT_OBJ_LEV_LOW = 0x16 + AUDIT_OBJ_PID = 0x526 + AUDIT_OBJ_ROLE = 0x14 + AUDIT_OBJ_TYPE = 0x15 + AUDIT_OBJ_UID = 0x6d + AUDIT_OBJ_USER = 0x13 + AUDIT_OPENAT2 = 0x539 + AUDIT_OPERATORS = 0x78000000 + AUDIT_PATH = 0x516 + AUDIT_PERM = 0x6a + AUDIT_PERM_ATTR = 0x8 + AUDIT_PERM_EXEC = 0x1 + AUDIT_PERM_READ = 0x4 + AUDIT_PERM_WRITE = 0x2 + AUDIT_PERS = 0xa + AUDIT_PID = 0x0 + AUDIT_POSSIBLE = 0x1 + AUDIT_PPID = 0x12 + AUDIT_PROCTITLE = 0x52f + AUDIT_REPLACE = 0x531 + AUDIT_SADDR_FAM = 0x71 + AUDIT_SECCOMP = 0x52e + AUDIT_SELINUX_ERR = 0x579 + AUDIT_SESSIONID = 0x19 + AUDIT_SET = 0x3e9 + AUDIT_SET_FEATURE = 0x3fa + AUDIT_SGID = 0x7 + AUDIT_SID_UNSET = 0xffffffff + AUDIT_SIGNAL_INFO = 0x3f2 + AUDIT_SOCKADDR = 0x51a + AUDIT_SOCKETCALL = 0x518 + AUDIT_STATUS_BACKLOG_LIMIT = 0x10 + AUDIT_STATUS_BACKLOG_WAIT_TIME = 0x20 + AUDIT_STATUS_BACKLOG_WAIT_TIME_ACTUAL = 0x80 + AUDIT_STATUS_ENABLED = 0x1 + AUDIT_STATUS_FAILURE = 0x2 + AUDIT_STATUS_LOST = 0x40 + AUDIT_STATUS_PID = 0x4 + AUDIT_STATUS_RATE_LIMIT = 0x8 + AUDIT_SUBJ_CLR = 0x11 + AUDIT_SUBJ_ROLE = 0xe + AUDIT_SUBJ_SEN = 0x10 + AUDIT_SUBJ_TYPE = 0xf + AUDIT_SUBJ_USER = 0xd + AUDIT_SUCCESS = 0x68 + AUDIT_SUID = 0x3 + AUDIT_SYSCALL = 0x514 + AUDIT_SYSCALL_CLASSES = 0x10 + AUDIT_TIME_ADJNTPVAL = 0x535 + AUDIT_TIME_INJOFFSET = 0x534 + AUDIT_TRIM = 0x3f6 + AUDIT_TTY = 0x527 + AUDIT_TTY_GET = 0x3f8 + AUDIT_TTY_SET = 0x3f9 + AUDIT_UID = 0x1 + AUDIT_UID_UNSET = 0xffffffff + AUDIT_UNUSED_BITS = 0x7fffc00 + AUDIT_URINGOP = 0x538 + AUDIT_USER = 0x3ed + AUDIT_USER_AVC = 0x453 + AUDIT_USER_TTY = 0x464 + AUDIT_VERSION_BACKLOG_LIMIT = 0x1 + AUDIT_VERSION_BACKLOG_WAIT_TIME = 0x2 + AUDIT_VERSION_LATEST = 0x7f + AUDIT_WATCH = 0x69 + AUDIT_WATCH_INS = 0x3ef + AUDIT_WATCH_LIST = 0x3f1 + AUDIT_WATCH_REM = 0x3f0 AUTOFS_SUPER_MAGIC = 0x187 B0 = 0x0 B110 = 0x3 @@ -183,6 +484,7 @@ const ( BPF_F_ALLOW_MULTI = 0x2 BPF_F_ALLOW_OVERRIDE = 0x1 BPF_F_ANY_ALIGNMENT = 0x2 + BPF_F_KPROBE_MULTI_RETURN = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 @@ -190,6 +492,8 @@ const ( BPF_F_TEST_RND_HI32 = 0x4 BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 + BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -259,6 +563,17 @@ const ( BUS_USB = 0x3 BUS_VIRTUAL = 0x6 CAN_BCM = 0x2 + CAN_CTRLMODE_3_SAMPLES = 0x4 + CAN_CTRLMODE_BERR_REPORTING = 0x10 + CAN_CTRLMODE_CC_LEN8_DLC = 0x100 + CAN_CTRLMODE_FD = 0x20 + CAN_CTRLMODE_FD_NON_ISO = 0x80 + CAN_CTRLMODE_LISTENONLY = 0x2 + CAN_CTRLMODE_LOOPBACK = 0x1 + CAN_CTRLMODE_ONE_SHOT = 0x8 + CAN_CTRLMODE_PRESUME_ACK = 0x40 + CAN_CTRLMODE_TDC_AUTO = 0x200 + CAN_CTRLMODE_TDC_MANUAL = 0x400 CAN_EFF_FLAG = 0x80000000 CAN_EFF_ID_BITS = 0x1d CAN_EFF_MASK = 0x1fffffff @@ -336,6 +651,7 @@ const ( CAN_RTR_FLAG = 0x40000000 CAN_SFF_ID_BITS = 0xb CAN_SFF_MASK = 0x7ff + CAN_TERMINATION_DISABLED = 0x0 CAN_TP16 = 0x3 CAN_TP20 = 0x4 CAP_AUDIT_CONTROL = 0x1e @@ -380,9 +696,11 @@ const ( CAP_SYS_TIME = 0x19 CAP_SYS_TTY_CONFIG = 0x1a CAP_WAKE_ALARM = 0x23 + CEPH_SUPER_MAGIC = 0xc36400 CFLUSH = 0xf CGROUP2_SUPER_MAGIC = 0x63677270 CGROUP_SUPER_MAGIC = 0x27e0eb + CIFS_SUPER_MAGIC = 0xff534d42 CLOCK_BOOTTIME = 0x7 CLOCK_BOOTTIME_ALARM = 0x9 CLOCK_DEFAULT = 0x0 @@ -502,9 +820,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2021-03-22)" + DM_VERSION_EXTRA = "-ioctl (2022-02-22)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2d + DM_VERSION_MINOR = 0x2e DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -520,6 +838,55 @@ const ( EFD_SEMAPHORE = 0x1 EFIVARFS_MAGIC = 0xde5e81e4 EFS_SUPER_MAGIC = 0x414a53 + EM_386 = 0x3 + EM_486 = 0x6 + EM_68K = 0x4 + EM_860 = 0x7 + EM_88K = 0x5 + EM_AARCH64 = 0xb7 + EM_ALPHA = 0x9026 + EM_ALTERA_NIOS2 = 0x71 + EM_ARCOMPACT = 0x5d + EM_ARCV2 = 0xc3 + EM_ARM = 0x28 + EM_BLACKFIN = 0x6a + EM_BPF = 0xf7 + EM_CRIS = 0x4c + EM_CSKY = 0xfc + EM_CYGNUS_M32R = 0x9041 + EM_CYGNUS_MN10300 = 0xbeef + EM_FRV = 0x5441 + EM_H8_300 = 0x2e + EM_HEXAGON = 0xa4 + EM_IA_64 = 0x32 + EM_LOONGARCH = 0x102 + EM_M32 = 0x1 + EM_M32R = 0x58 + EM_MICROBLAZE = 0xbd + EM_MIPS = 0x8 + EM_MIPS_RS3_LE = 0xa + EM_MIPS_RS4_BE = 0xa + EM_MN10300 = 0x59 + EM_NDS32 = 0xa7 + EM_NONE = 0x0 + EM_OPENRISC = 0x5c + EM_PARISC = 0xf + EM_PPC = 0x14 + EM_PPC64 = 0x15 + EM_RISCV = 0xf3 + EM_S390 = 0x16 + EM_S390_OLD = 0xa390 + EM_SH = 0x2a + EM_SPARC = 0x2 + EM_SPARC32PLUS = 0x12 + EM_SPARCV9 = 0x2b + EM_SPU = 0x17 + EM_TILEGX = 0xbf + EM_TILEPRO = 0xbc + EM_TI_C6000 = 0x8c + EM_UNICORE = 0x6e + EM_X86_64 = 0x3e + EM_XTENSA = 0x5e ENCODING_DEFAULT = 0x0 ENCODING_FM_MARK = 0x3 ENCODING_FM_SPACE = 0x4 @@ -697,6 +1064,7 @@ const ( ETH_P_EDSA = 0xdada ETH_P_ERSPAN = 0x88be ETH_P_ERSPAN2 = 0x22eb + ETH_P_ETHERCAT = 0x88a4 ETH_P_FCOE = 0x8906 ETH_P_FIP = 0x8914 ETH_P_HDLC = 0x19 @@ -734,6 +1102,7 @@ const ( ETH_P_PPP_MP = 0x8 ETH_P_PPP_SES = 0x8864 ETH_P_PREAUTH = 0x88c7 + ETH_P_PROFINET = 0x8892 ETH_P_PRP = 0x88fb ETH_P_PUP = 0x200 ETH_P_PUPAT = 0x201 @@ -741,6 +1110,7 @@ const ( ETH_P_QINQ2 = 0x9200 ETH_P_QINQ3 = 0x9300 ETH_P_RARP = 0x8035 + ETH_P_REALTEK = 0x8899 ETH_P_SCA = 0x6007 ETH_P_SLOW = 0x8809 ETH_P_SNAP = 0x5 @@ -770,6 +1140,7 @@ const ( EV_SYN = 0x0 EV_VERSION = 0x10001 EXABYTE_ENABLE_NEST = 0xf0 + EXFAT_SUPER_MAGIC = 0x2011bab0 EXT2_SUPER_MAGIC = 0xef53 EXT3_SUPER_MAGIC = 0xef53 EXT4_SUPER_MAGIC = 0xef53 @@ -810,12 +1181,17 @@ const ( FAN_EPIDFD = -0x2 FAN_EVENT_INFO_TYPE_DFID = 0x3 FAN_EVENT_INFO_TYPE_DFID_NAME = 0x2 + FAN_EVENT_INFO_TYPE_ERROR = 0x5 FAN_EVENT_INFO_TYPE_FID = 0x1 + FAN_EVENT_INFO_TYPE_NEW_DFID_NAME = 0xc + FAN_EVENT_INFO_TYPE_OLD_DFID_NAME = 0xa FAN_EVENT_INFO_TYPE_PIDFD = 0x4 FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 + FAN_FS_ERROR = 0x8000 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 + FAN_MARK_EVICTABLE = 0x200 FAN_MARK_FILESYSTEM = 0x100 FAN_MARK_FLUSH = 0x80 FAN_MARK_IGNORED_MASK = 0x20 @@ -838,17 +1214,27 @@ const ( FAN_OPEN_EXEC_PERM = 0x40000 FAN_OPEN_PERM = 0x10000 FAN_Q_OVERFLOW = 0x4000 + FAN_RENAME = 0x10000000 FAN_REPORT_DFID_NAME = 0xc00 + FAN_REPORT_DFID_NAME_TARGET = 0x1e00 FAN_REPORT_DIR_FID = 0x400 FAN_REPORT_FID = 0x200 FAN_REPORT_NAME = 0x800 FAN_REPORT_PIDFD = 0x80 + FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 FD_SETSIZE = 0x400 FF0 = 0x0 + FIB_RULE_DEV_DETACHED = 0x8 + FIB_RULE_FIND_SADDR = 0x10000 + FIB_RULE_IIF_DETACHED = 0x8 + FIB_RULE_INVERT = 0x2 + FIB_RULE_OIF_DETACHED = 0x10 + FIB_RULE_PERMANENT = 0x1 + FIB_RULE_UNRESOLVED = 0x4 FIDEDUPERANGE = 0xc0189436 FSCRYPT_KEY_DESCRIPTOR_SIZE = 0x8 FSCRYPT_KEY_DESC_PREFIX = "fscrypt:" @@ -911,6 +1297,7 @@ const ( FS_VERITY_METADATA_TYPE_DESCRIPTOR = 0x2 FS_VERITY_METADATA_TYPE_MERKLE_TREE = 0x1 FS_VERITY_METADATA_TYPE_SIGNATURE = 0x3 + FUSE_SUPER_MAGIC = 0x65735546 FUTEXFS_SUPER_MAGIC = 0xbad1dea F_ADD_SEALS = 0x409 F_DUPFD = 0x0 @@ -1023,7 +1410,7 @@ const ( IFA_F_STABLE_PRIVACY = 0x800 IFA_F_TEMPORARY = 0x1 IFA_F_TENTATIVE = 0x40 - IFA_MAX = 0xa + IFA_MAX = 0xb IFF_ALLMULTI = 0x200 IFF_ATTACH_QUEUE = 0x200 IFF_AUTOMEDIA = 0x4000 @@ -1264,15 +1651,21 @@ const ( IP_XFRM_POLICY = 0x11 ISOFS_SUPER_MAGIC = 0x9660 ISTRIP = 0x20 + ITIMER_PROF = 0x2 + ITIMER_REAL = 0x0 + ITIMER_VIRTUAL = 0x1 IUTF8 = 0x4000 IXANY = 0x800 JFFS2_SUPER_MAGIC = 0x72b6 + KCMPROTO_CONNECTED = 0x0 + KCM_RECV_DISABLE = 0x1 KEXEC_ARCH_386 = 0x30000 KEXEC_ARCH_68K = 0x40000 KEXEC_ARCH_AARCH64 = 0xb70000 KEXEC_ARCH_ARM = 0x280000 KEXEC_ARCH_DEFAULT = 0x0 KEXEC_ARCH_IA_64 = 0x320000 + KEXEC_ARCH_LOONGARCH = 0x1020000 KEXEC_ARCH_MASK = 0xffff0000 KEXEC_ARCH_MIPS = 0x80000 KEXEC_ARCH_MIPS_LE = 0xa0000 @@ -1365,6 +1758,7 @@ const ( LANDLOCK_ACCESS_FS_MAKE_SYM = 0x1000 LANDLOCK_ACCESS_FS_READ_DIR = 0x8 LANDLOCK_ACCESS_FS_READ_FILE = 0x4 + LANDLOCK_ACCESS_FS_REFER = 0x2000 LANDLOCK_ACCESS_FS_REMOVE_DIR = 0x10 LANDLOCK_ACCESS_FS_REMOVE_FILE = 0x20 LANDLOCK_ACCESS_FS_WRITE_FILE = 0x2 @@ -1474,6 +1868,7 @@ const ( MNT_DETACH = 0x2 MNT_EXPIRE = 0x4 MNT_FORCE = 0x1 + MODULE_INIT_COMPRESSED_FILE = 0x4 MODULE_INIT_IGNORE_MODVERSIONS = 0x1 MODULE_INIT_IGNORE_VERMAGIC = 0x2 MOUNT_ATTR_IDMAP = 0x100000 @@ -1719,6 +2114,7 @@ const ( NLM_F_ACK_TLVS = 0x200 NLM_F_APPEND = 0x800 NLM_F_ATOMIC = 0x400 + NLM_F_BULK = 0x200 NLM_F_CAPPED = 0x100 NLM_F_CREATE = 0x400 NLM_F_DUMP = 0x300 @@ -1827,6 +2223,11 @@ const ( PERF_MEM_BLK_DATA = 0x2 PERF_MEM_BLK_NA = 0x1 PERF_MEM_BLK_SHIFT = 0x28 + PERF_MEM_HOPS_0 = 0x1 + PERF_MEM_HOPS_1 = 0x2 + PERF_MEM_HOPS_2 = 0x3 + PERF_MEM_HOPS_3 = 0x4 + PERF_MEM_HOPS_SHIFT = 0x2b PERF_MEM_LOCK_LOCKED = 0x2 PERF_MEM_LOCK_NA = 0x1 PERF_MEM_LOCK_SHIFT = 0x18 @@ -1986,6 +2387,9 @@ const ( PR_SCHED_CORE_CREATE = 0x1 PR_SCHED_CORE_GET = 0x0 PR_SCHED_CORE_MAX = 0x4 + PR_SCHED_CORE_SCOPE_PROCESS_GROUP = 0x2 + PR_SCHED_CORE_SCOPE_THREAD = 0x0 + PR_SCHED_CORE_SCOPE_THREAD_GROUP = 0x1 PR_SCHED_CORE_SHARE_FROM = 0x3 PR_SCHED_CORE_SHARE_TO = 0x2 PR_SET_CHILD_SUBREAPER = 0x24 @@ -2026,6 +2430,13 @@ const ( PR_SET_TIMING = 0xe PR_SET_TSC = 0x1a PR_SET_UNALIGN = 0x6 + PR_SET_VMA = 0x53564d41 + PR_SET_VMA_ANON_NAME = 0x0 + PR_SME_GET_VL = 0x40 + PR_SME_SET_VL = 0x3f + PR_SME_SET_VL_ONEXEC = 0x40000 + PR_SME_VL_INHERIT = 0x20000 + PR_SME_VL_LEN_MASK = 0xffff PR_SPEC_DISABLE = 0x4 PR_SPEC_DISABLE_NOEXEC = 0x10 PR_SPEC_ENABLE = 0x2 @@ -2109,6 +2520,10 @@ const ( PTRACE_SYSCALL_INFO_NONE = 0x0 PTRACE_SYSCALL_INFO_SECCOMP = 0x3 PTRACE_TRACEME = 0x0 + P_ALL = 0x0 + P_PGID = 0x2 + P_PID = 0x1 + P_PIDFD = 0x3 QNX4_SUPER_MAGIC = 0x2f QNX6_SUPER_MAGIC = 0x68191122 RAMFS_MAGIC = 0x858458f6 @@ -2167,12 +2582,24 @@ const ( RTCF_NAT = 0x800000 RTCF_VALVE = 0x200000 RTC_AF = 0x20 + RTC_BSM_DIRECT = 0x1 + RTC_BSM_DISABLED = 0x0 + RTC_BSM_LEVEL = 0x2 + RTC_BSM_STANDBY = 0x3 RTC_FEATURE_ALARM = 0x0 + RTC_FEATURE_ALARM_RES_2S = 0x3 RTC_FEATURE_ALARM_RES_MINUTE = 0x1 - RTC_FEATURE_CNT = 0x3 + RTC_FEATURE_ALARM_WAKEUP_ONLY = 0x7 + RTC_FEATURE_BACKUP_SWITCH_MODE = 0x6 + RTC_FEATURE_CNT = 0x8 + RTC_FEATURE_CORRECTION = 0x5 RTC_FEATURE_NEED_WEEK_DAY = 0x2 + RTC_FEATURE_UPDATE_INTERRUPT = 0x4 RTC_IRQF = 0x80 RTC_MAX_FREQ = 0x2000 + RTC_PARAM_BACKUP_SWITCH_MODE = 0x2 + RTC_PARAM_CORRECTION = 0x1 + RTC_PARAM_FEATURES = 0x0 RTC_PF = 0x40 RTC_UF = 0x10 RTF_ADDRCLASSMASK = 0xf8000000 @@ -2238,6 +2665,7 @@ const ( RTM_DELRULE = 0x21 RTM_DELTCLASS = 0x29 RTM_DELTFILTER = 0x2d + RTM_DELTUNNEL = 0x79 RTM_DELVLAN = 0x71 RTM_F_CLONED = 0x200 RTM_F_EQUALIZE = 0x400 @@ -2270,8 +2698,9 @@ const ( RTM_GETSTATS = 0x5e RTM_GETTCLASS = 0x2a RTM_GETTFILTER = 0x2e + RTM_GETTUNNEL = 0x7a RTM_GETVLAN = 0x72 - RTM_MAX = 0x77 + RTM_MAX = 0x7b RTM_NEWACTION = 0x30 RTM_NEWADDR = 0x14 RTM_NEWADDRLABEL = 0x48 @@ -2295,11 +2724,13 @@ const ( RTM_NEWSTATS = 0x5c RTM_NEWTCLASS = 0x28 RTM_NEWTFILTER = 0x2c - RTM_NR_FAMILIES = 0x1a - RTM_NR_MSGTYPES = 0x68 + RTM_NEWTUNNEL = 0x78 + RTM_NR_FAMILIES = 0x1b + RTM_NR_MSGTYPES = 0x6c RTM_SETDCB = 0x4f RTM_SETLINK = 0x13 RTM_SETNEIGHTBL = 0x43 + RTM_SETSTATS = 0x5f RTNH_ALIGNTO = 0x4 RTNH_COMPARE_MASK = 0x59 RTNH_F_DEAD = 0x1 @@ -2423,6 +2854,9 @@ const ( SIOCGSTAMPNS = 0x8907 SIOCGSTAMPNS_OLD = 0x8907 SIOCGSTAMP_OLD = 0x8906 + SIOCKCMATTACH = 0x89e0 + SIOCKCMCLONE = 0x89e2 + SIOCKCMUNATTACH = 0x89e1 SIOCOUTQNSD = 0x894b SIOCPROTOPRIVATE = 0x89e0 SIOCRTMSG = 0x890d @@ -2465,6 +2899,7 @@ const ( SMART_STATUS = 0xda SMART_WRITE_LOG_SECTOR = 0xd6 SMART_WRITE_THRESHOLDS = 0xd7 + SMB2_SUPER_MAGIC = 0xfe534d42 SMB_SUPER_MAGIC = 0x517b SOCKFS_MAGIC = 0x534f434b SOCK_BUF_LOCK_MASK = 0x3 @@ -2476,6 +2911,9 @@ const ( SOCK_RDM = 0x4 SOCK_SEQPACKET = 0x5 SOCK_SNDBUF_LOCK = 0x1 + SOCK_TXREHASH_DEFAULT = 0xff + SOCK_TXREHASH_DISABLED = 0x0 + SOCK_TXREHASH_ENABLED = 0x1 SOL_AAL = 0x109 SOL_ALG = 0x117 SOL_ATM = 0x108 @@ -2491,6 +2929,8 @@ const ( SOL_IUCV = 0x115 SOL_KCM = 0x119 SOL_LLC = 0x10c + SOL_MCTP = 0x11d + SOL_MPTCP = 0x11c SOL_NETBEUI = 0x10b SOL_NETLINK = 0x10e SOL_NFC = 0x118 @@ -2500,6 +2940,7 @@ const ( SOL_RAW = 0xff SOL_RDS = 0x114 SOL_RXRPC = 0x110 + SOL_SMC = 0x11e SOL_TCP = 0x6 SOL_TIPC = 0x10f SOL_TLS = 0x11a @@ -2532,6 +2973,8 @@ const ( SO_VM_SOCKETS_BUFFER_MIN_SIZE = 0x1 SO_VM_SOCKETS_BUFFER_SIZE = 0x0 SO_VM_SOCKETS_CONNECT_TIMEOUT = 0x6 + SO_VM_SOCKETS_CONNECT_TIMEOUT_NEW = 0x8 + SO_VM_SOCKETS_CONNECT_TIMEOUT_OLD = 0x6 SO_VM_SOCKETS_NONBLOCK_TXRX = 0x7 SO_VM_SOCKETS_PEER_HOST_VM_ID = 0x3 SO_VM_SOCKETS_TRUSTED = 0x5 @@ -2604,7 +3047,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xa + TASKSTATS_VERSION = 0xd TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index 3ca40ca7..274e2dab 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -5,7 +5,7 @@ // +build 386,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 _const.go package unix @@ -250,6 +250,8 @@ const ( RTC_EPOCH_SET = 0x4004700e RTC_IRQP_READ = 0x8004700b RTC_IRQP_SET = 0x4004700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 RTC_PIE_OFF = 0x7006 RTC_PIE_ON = 0x7005 RTC_PLL_GET = 0x801c7011 @@ -324,9 +326,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -347,6 +351,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index ead33209..95b6eeed 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -5,7 +5,7 @@ // +build amd64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 _const.go package unix @@ -251,6 +251,8 @@ const ( RTC_EPOCH_SET = 0x4008700e RTC_IRQP_READ = 0x8008700b RTC_IRQP_SET = 0x4008700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 RTC_PIE_OFF = 0x7006 RTC_PIE_ON = 0x7005 RTC_PLL_GET = 0x80207011 @@ -325,9 +327,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -348,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index 39bdc945..918cd130 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -5,7 +5,7 @@ // +build arm,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -257,6 +257,8 @@ const ( RTC_EPOCH_SET = 0x4004700e RTC_IRQP_READ = 0x8004700b RTC_IRQP_SET = 0x4004700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 RTC_PIE_OFF = 0x7006 RTC_PIE_ON = 0x7005 RTC_PLL_GET = 0x801c7011 @@ -331,9 +333,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -354,6 +358,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9aec987d..3907dc5a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -5,7 +5,7 @@ // +build arm64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char _const.go package unix @@ -247,6 +247,8 @@ const ( RTC_EPOCH_SET = 0x4008700e RTC_IRQP_READ = 0x8008700b RTC_IRQP_SET = 0x4008700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 RTC_PIE_OFF = 0x7006 RTC_PIE_ON = 0x7005 RTC_PLL_GET = 0x80207011 @@ -321,9 +323,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -344,6 +348,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 @@ -508,6 +513,7 @@ const ( WORDSIZE = 0x40 XCASE = 0x4 XTABS = 0x1800 + ZA_MAGIC = 0x54366345 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go new file mode 100644 index 00000000..03d5c105 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -0,0 +1,818 @@ +// mkerrors.sh -Wall -Werror -static -I/tmp/include +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build loong64 && linux +// +build loong64,linux + +// Code generated by cmd/cgo -godefs; DO NOT EDIT. +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go + +package unix + +import "syscall" + +const ( + B1000000 = 0x1008 + B115200 = 0x1002 + B1152000 = 0x1009 + B1500000 = 0x100a + B2000000 = 0x100b + B230400 = 0x1003 + B2500000 = 0x100c + B3000000 = 0x100d + B3500000 = 0x100e + B4000000 = 0x100f + B460800 = 0x1004 + B500000 = 0x1005 + B57600 = 0x1001 + B576000 = 0x1006 + B921600 = 0x1007 + BLKBSZGET = 0x80081270 + BLKBSZSET = 0x40081271 + BLKFLSBUF = 0x1261 + BLKFRAGET = 0x1265 + BLKFRASET = 0x1264 + BLKGETSIZE = 0x1260 + BLKGETSIZE64 = 0x80081272 + BLKPBSZGET = 0x127b + BLKRAGET = 0x1263 + BLKRASET = 0x1262 + BLKROGET = 0x125e + BLKROSET = 0x125d + BLKRRPART = 0x125f + BLKSECTGET = 0x1267 + BLKSECTSET = 0x1266 + BLKSSZGET = 0x1268 + BOTHER = 0x1000 + BS1 = 0x2000 + BSDLY = 0x2000 + CBAUD = 0x100f + CBAUDEX = 0x1000 + CIBAUD = 0x100f0000 + CLOCAL = 0x800 + CR1 = 0x200 + CR2 = 0x400 + CR3 = 0x600 + CRDLY = 0x600 + CREAD = 0x80 + CS6 = 0x10 + CS7 = 0x20 + CS8 = 0x30 + CSIZE = 0x30 + CSTOPB = 0x40 + ECCGETLAYOUT = 0x81484d11 + ECCGETSTATS = 0x80104d12 + ECHOCTL = 0x200 + ECHOE = 0x10 + ECHOK = 0x20 + ECHOKE = 0x800 + ECHONL = 0x40 + ECHOPRT = 0x400 + EFD_CLOEXEC = 0x80000 + EFD_NONBLOCK = 0x800 + EPOLL_CLOEXEC = 0x80000 + EXTPROC = 0x10000 + FF1 = 0x8000 + FFDLY = 0x8000 + FICLONE = 0x40049409 + FICLONERANGE = 0x4020940d + FLUSHO = 0x1000 + FPU_CTX_MAGIC = 0x46505501 + FS_IOC_ENABLE_VERITY = 0x40806685 + FS_IOC_GETFLAGS = 0x80086601 + FS_IOC_GET_ENCRYPTION_NONCE = 0x8010661b + FS_IOC_GET_ENCRYPTION_POLICY = 0x400c6615 + FS_IOC_GET_ENCRYPTION_PWSALT = 0x40106614 + FS_IOC_SETFLAGS = 0x40086602 + FS_IOC_SET_ENCRYPTION_POLICY = 0x800c6613 + F_GETLK = 0x5 + F_GETLK64 = 0x5 + F_GETOWN = 0x9 + F_RDLCK = 0x0 + F_SETLK = 0x6 + F_SETLK64 = 0x6 + F_SETLKW = 0x7 + F_SETLKW64 = 0x7 + F_SETOWN = 0x8 + F_UNLCK = 0x2 + F_WRLCK = 0x1 + HIDIOCGRAWINFO = 0x80084803 + HIDIOCGRDESC = 0x90044802 + HIDIOCGRDESCSIZE = 0x80044801 + HUPCL = 0x400 + ICANON = 0x2 + IEXTEN = 0x8000 + IN_CLOEXEC = 0x80000 + IN_NONBLOCK = 0x800 + IOCTL_VM_SOCKETS_GET_LOCAL_CID = 0x7b9 + ISIG = 0x1 + IUCLC = 0x200 + IXOFF = 0x1000 + IXON = 0x400 + MAP_ANON = 0x20 + MAP_ANONYMOUS = 0x20 + MAP_DENYWRITE = 0x800 + MAP_EXECUTABLE = 0x1000 + MAP_GROWSDOWN = 0x100 + MAP_HUGETLB = 0x40000 + MAP_LOCKED = 0x2000 + MAP_NONBLOCK = 0x10000 + MAP_NORESERVE = 0x4000 + MAP_POPULATE = 0x8000 + MAP_STACK = 0x20000 + MAP_SYNC = 0x80000 + MCL_CURRENT = 0x1 + MCL_FUTURE = 0x2 + MCL_ONFAULT = 0x4 + MEMERASE = 0x40084d02 + MEMERASE64 = 0x40104d14 + MEMGETBADBLOCK = 0x40084d0b + MEMGETINFO = 0x80204d01 + MEMGETOOBSEL = 0x80c84d0a + MEMGETREGIONCOUNT = 0x80044d07 + MEMISLOCKED = 0x80084d17 + MEMLOCK = 0x40084d05 + MEMREADOOB = 0xc0104d04 + MEMSETBADBLOCK = 0x40084d0c + MEMUNLOCK = 0x40084d06 + MEMWRITEOOB = 0xc0104d03 + MTDFILEMODE = 0x4d13 + NFDBITS = 0x40 + NLDLY = 0x100 + NOFLSH = 0x80 + NS_GET_NSTYPE = 0xb703 + NS_GET_OWNER_UID = 0xb704 + NS_GET_PARENT = 0xb702 + NS_GET_USERNS = 0xb701 + OLCUC = 0x2 + ONLCR = 0x4 + OTPERASE = 0x400c4d19 + OTPGETREGIONCOUNT = 0x40044d0e + OTPGETREGIONINFO = 0x400c4d0f + OTPLOCK = 0x800c4d10 + OTPSELECT = 0x80044d0d + O_APPEND = 0x400 + O_ASYNC = 0x2000 + O_CLOEXEC = 0x80000 + O_CREAT = 0x40 + O_DIRECT = 0x4000 + O_DIRECTORY = 0x10000 + O_DSYNC = 0x1000 + O_EXCL = 0x80 + O_FSYNC = 0x101000 + O_LARGEFILE = 0x0 + O_NDELAY = 0x800 + O_NOATIME = 0x40000 + O_NOCTTY = 0x100 + O_NOFOLLOW = 0x20000 + O_NONBLOCK = 0x800 + O_PATH = 0x200000 + O_RSYNC = 0x101000 + O_SYNC = 0x101000 + O_TMPFILE = 0x410000 + O_TRUNC = 0x200 + PARENB = 0x100 + PARODD = 0x200 + PENDIN = 0x4000 + PERF_EVENT_IOC_DISABLE = 0x2401 + PERF_EVENT_IOC_ENABLE = 0x2400 + PERF_EVENT_IOC_ID = 0x80082407 + PERF_EVENT_IOC_MODIFY_ATTRIBUTES = 0x4008240b + PERF_EVENT_IOC_PAUSE_OUTPUT = 0x40042409 + PERF_EVENT_IOC_PERIOD = 0x40082404 + PERF_EVENT_IOC_QUERY_BPF = 0xc008240a + PERF_EVENT_IOC_REFRESH = 0x2402 + PERF_EVENT_IOC_RESET = 0x2403 + PERF_EVENT_IOC_SET_BPF = 0x40042408 + PERF_EVENT_IOC_SET_FILTER = 0x40082406 + PERF_EVENT_IOC_SET_OUTPUT = 0x2405 + PPPIOCATTACH = 0x4004743d + PPPIOCATTCHAN = 0x40047438 + PPPIOCBRIDGECHAN = 0x40047435 + PPPIOCCONNECT = 0x4004743a + PPPIOCDETACH = 0x4004743c + PPPIOCDISCONN = 0x7439 + PPPIOCGASYNCMAP = 0x80047458 + PPPIOCGCHAN = 0x80047437 + PPPIOCGDEBUG = 0x80047441 + PPPIOCGFLAGS = 0x8004745a + PPPIOCGIDLE = 0x8010743f + PPPIOCGIDLE32 = 0x8008743f + PPPIOCGIDLE64 = 0x8010743f + PPPIOCGL2TPSTATS = 0x80487436 + PPPIOCGMRU = 0x80047453 + PPPIOCGRASYNCMAP = 0x80047455 + PPPIOCGUNIT = 0x80047456 + PPPIOCGXASYNCMAP = 0x80207450 + PPPIOCSACTIVE = 0x40107446 + PPPIOCSASYNCMAP = 0x40047457 + PPPIOCSCOMPRESS = 0x4010744d + PPPIOCSDEBUG = 0x40047440 + PPPIOCSFLAGS = 0x40047459 + PPPIOCSMAXCID = 0x40047451 + PPPIOCSMRRU = 0x4004743b + PPPIOCSMRU = 0x40047452 + PPPIOCSNPMODE = 0x4008744b + PPPIOCSPASS = 0x40107447 + PPPIOCSRASYNCMAP = 0x40047454 + PPPIOCSXASYNCMAP = 0x4020744f + PPPIOCUNBRIDGECHAN = 0x7434 + PPPIOCXFERUNIT = 0x744e + PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTRACE_SYSEMU = 0x1f + PTRACE_SYSEMU_SINGLESTEP = 0x20 + RLIMIT_AS = 0x9 + RLIMIT_MEMLOCK = 0x8 + RLIMIT_NOFILE = 0x7 + RLIMIT_NPROC = 0x6 + RLIMIT_RSS = 0x5 + RNDADDENTROPY = 0x40085203 + RNDADDTOENTCNT = 0x40045201 + RNDCLEARPOOL = 0x5206 + RNDGETENTCNT = 0x80045200 + RNDGETPOOL = 0x80085202 + RNDRESEEDCRNG = 0x5207 + RNDZAPENTCNT = 0x5204 + RTC_AIE_OFF = 0x7002 + RTC_AIE_ON = 0x7001 + RTC_ALM_READ = 0x80247008 + RTC_ALM_SET = 0x40247007 + RTC_EPOCH_READ = 0x8008700d + RTC_EPOCH_SET = 0x4008700e + RTC_IRQP_READ = 0x8008700b + RTC_IRQP_SET = 0x4008700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 + RTC_PIE_OFF = 0x7006 + RTC_PIE_ON = 0x7005 + RTC_PLL_GET = 0x80207011 + RTC_PLL_SET = 0x40207012 + RTC_RD_TIME = 0x80247009 + RTC_SET_TIME = 0x4024700a + RTC_UIE_OFF = 0x7004 + RTC_UIE_ON = 0x7003 + RTC_VL_CLR = 0x7014 + RTC_VL_READ = 0x80047013 + RTC_WIE_OFF = 0x7010 + RTC_WIE_ON = 0x700f + RTC_WKALM_RD = 0x80287010 + RTC_WKALM_SET = 0x4028700f + SCM_TIMESTAMPING = 0x25 + SCM_TIMESTAMPING_OPT_STATS = 0x36 + SCM_TIMESTAMPING_PKTINFO = 0x3a + SCM_TIMESTAMPNS = 0x23 + SCM_TXTIME = 0x3d + SCM_WIFI_STATUS = 0x29 + SFD_CLOEXEC = 0x80000 + SFD_NONBLOCK = 0x800 + SIOCATMARK = 0x8905 + SIOCGPGRP = 0x8904 + SIOCGSTAMPNS_NEW = 0x80108907 + SIOCGSTAMP_NEW = 0x80108906 + SIOCINQ = 0x541b + SIOCOUTQ = 0x5411 + SIOCSPGRP = 0x8902 + SOCK_CLOEXEC = 0x80000 + SOCK_DGRAM = 0x2 + SOCK_NONBLOCK = 0x800 + SOCK_STREAM = 0x1 + SOL_SOCKET = 0x1 + SO_ACCEPTCONN = 0x1e + SO_ATTACH_BPF = 0x32 + SO_ATTACH_REUSEPORT_CBPF = 0x33 + SO_ATTACH_REUSEPORT_EBPF = 0x34 + SO_BINDTODEVICE = 0x19 + SO_BINDTOIFINDEX = 0x3e + SO_BPF_EXTENSIONS = 0x30 + SO_BROADCAST = 0x6 + SO_BSDCOMPAT = 0xe + SO_BUF_LOCK = 0x48 + SO_BUSY_POLL = 0x2e + SO_BUSY_POLL_BUDGET = 0x46 + SO_CNX_ADVICE = 0x35 + SO_COOKIE = 0x39 + SO_DETACH_REUSEPORT_BPF = 0x44 + SO_DOMAIN = 0x27 + SO_DONTROUTE = 0x5 + SO_ERROR = 0x4 + SO_INCOMING_CPU = 0x31 + SO_INCOMING_NAPI_ID = 0x38 + SO_KEEPALIVE = 0x9 + SO_LINGER = 0xd + SO_LOCK_FILTER = 0x2c + SO_MARK = 0x24 + SO_MAX_PACING_RATE = 0x2f + SO_MEMINFO = 0x37 + SO_NETNS_COOKIE = 0x47 + SO_NOFCS = 0x2b + SO_OOBINLINE = 0xa + SO_PASSCRED = 0x10 + SO_PASSSEC = 0x22 + SO_PEEK_OFF = 0x2a + SO_PEERCRED = 0x11 + SO_PEERGROUPS = 0x3b + SO_PEERSEC = 0x1f + SO_PREFER_BUSY_POLL = 0x45 + SO_PROTOCOL = 0x26 + SO_RCVBUF = 0x8 + SO_RCVBUFFORCE = 0x21 + SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b + SO_RCVTIMEO = 0x14 + SO_RCVTIMEO_NEW = 0x42 + SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 + SO_REUSEADDR = 0x2 + SO_REUSEPORT = 0xf + SO_RXQ_OVFL = 0x28 + SO_SECURITY_AUTHENTICATION = 0x16 + SO_SECURITY_ENCRYPTION_NETWORK = 0x18 + SO_SECURITY_ENCRYPTION_TRANSPORT = 0x17 + SO_SELECT_ERR_QUEUE = 0x2d + SO_SNDBUF = 0x7 + SO_SNDBUFFORCE = 0x20 + SO_SNDLOWAT = 0x13 + SO_SNDTIMEO = 0x15 + SO_SNDTIMEO_NEW = 0x43 + SO_SNDTIMEO_OLD = 0x15 + SO_TIMESTAMPING = 0x25 + SO_TIMESTAMPING_NEW = 0x41 + SO_TIMESTAMPING_OLD = 0x25 + SO_TIMESTAMPNS = 0x23 + SO_TIMESTAMPNS_NEW = 0x40 + SO_TIMESTAMPNS_OLD = 0x23 + SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a + SO_TXTIME = 0x3d + SO_TYPE = 0x3 + SO_WIFI_STATUS = 0x29 + SO_ZEROCOPY = 0x3c + TAB1 = 0x800 + TAB2 = 0x1000 + TAB3 = 0x1800 + TABDLY = 0x1800 + TCFLSH = 0x540b + TCGETA = 0x5405 + TCGETS = 0x5401 + TCGETS2 = 0x802c542a + TCGETX = 0x5432 + TCSAFLUSH = 0x2 + TCSBRK = 0x5409 + TCSBRKP = 0x5425 + TCSETA = 0x5406 + TCSETAF = 0x5408 + TCSETAW = 0x5407 + TCSETS = 0x5402 + TCSETS2 = 0x402c542b + TCSETSF = 0x5404 + TCSETSF2 = 0x402c542d + TCSETSW = 0x5403 + TCSETSW2 = 0x402c542c + TCSETX = 0x5433 + TCSETXF = 0x5434 + TCSETXW = 0x5435 + TCXONC = 0x540a + TFD_CLOEXEC = 0x80000 + TFD_NONBLOCK = 0x800 + TIOCCBRK = 0x5428 + TIOCCONS = 0x541d + TIOCEXCL = 0x540c + TIOCGDEV = 0x80045432 + TIOCGETD = 0x5424 + TIOCGEXCL = 0x80045440 + TIOCGICOUNT = 0x545d + TIOCGISO7816 = 0x80285442 + TIOCGLCKTRMIOS = 0x5456 + TIOCGPGRP = 0x540f + TIOCGPKT = 0x80045438 + TIOCGPTLCK = 0x80045439 + TIOCGPTN = 0x80045430 + TIOCGPTPEER = 0x5441 + TIOCGRS485 = 0x542e + TIOCGSERIAL = 0x541e + TIOCGSID = 0x5429 + TIOCGSOFTCAR = 0x5419 + TIOCGWINSZ = 0x5413 + TIOCINQ = 0x541b + TIOCLINUX = 0x541c + TIOCMBIC = 0x5417 + TIOCMBIS = 0x5416 + TIOCMGET = 0x5415 + TIOCMIWAIT = 0x545c + TIOCMSET = 0x5418 + TIOCM_CAR = 0x40 + TIOCM_CD = 0x40 + TIOCM_CTS = 0x20 + TIOCM_DSR = 0x100 + TIOCM_RI = 0x80 + TIOCM_RNG = 0x80 + TIOCM_SR = 0x10 + TIOCM_ST = 0x8 + TIOCNOTTY = 0x5422 + TIOCNXCL = 0x540d + TIOCOUTQ = 0x5411 + TIOCPKT = 0x5420 + TIOCSBRK = 0x5427 + TIOCSCTTY = 0x540e + TIOCSERCONFIG = 0x5453 + TIOCSERGETLSR = 0x5459 + TIOCSERGETMULTI = 0x545a + TIOCSERGSTRUCT = 0x5458 + TIOCSERGWILD = 0x5454 + TIOCSERSETMULTI = 0x545b + TIOCSERSWILD = 0x5455 + TIOCSER_TEMT = 0x1 + TIOCSETD = 0x5423 + TIOCSIG = 0x40045436 + TIOCSISO7816 = 0xc0285443 + TIOCSLCKTRMIOS = 0x5457 + TIOCSPGRP = 0x5410 + TIOCSPTLCK = 0x40045431 + TIOCSRS485 = 0x542f + TIOCSSERIAL = 0x541f + TIOCSSOFTCAR = 0x541a + TIOCSTI = 0x5412 + TIOCSWINSZ = 0x5414 + TIOCVHANGUP = 0x5437 + TOSTOP = 0x100 + TUNATTACHFILTER = 0x401054d5 + TUNDETACHFILTER = 0x401054d6 + TUNGETDEVNETNS = 0x54e3 + TUNGETFEATURES = 0x800454cf + TUNGETFILTER = 0x801054db + TUNGETIFF = 0x800454d2 + TUNGETSNDBUF = 0x800454d3 + TUNGETVNETBE = 0x800454df + TUNGETVNETHDRSZ = 0x800454d7 + TUNGETVNETLE = 0x800454dd + TUNSETCARRIER = 0x400454e2 + TUNSETDEBUG = 0x400454c9 + TUNSETFILTEREBPF = 0x800454e1 + TUNSETGROUP = 0x400454ce + TUNSETIFF = 0x400454ca + TUNSETIFINDEX = 0x400454da + TUNSETLINK = 0x400454cd + TUNSETNOCSUM = 0x400454c8 + TUNSETOFFLOAD = 0x400454d0 + TUNSETOWNER = 0x400454cc + TUNSETPERSIST = 0x400454cb + TUNSETQUEUE = 0x400454d9 + TUNSETSNDBUF = 0x400454d4 + TUNSETSTEERINGEBPF = 0x800454e0 + TUNSETTXFILTER = 0x400454d1 + TUNSETVNETBE = 0x400454de + TUNSETVNETHDRSZ = 0x400454d8 + TUNSETVNETLE = 0x400454dc + UBI_IOCATT = 0x40186f40 + UBI_IOCDET = 0x40046f41 + UBI_IOCEBCH = 0x40044f02 + UBI_IOCEBER = 0x40044f01 + UBI_IOCEBISMAP = 0x80044f05 + UBI_IOCEBMAP = 0x40084f03 + UBI_IOCEBUNMAP = 0x40044f04 + UBI_IOCMKVOL = 0x40986f00 + UBI_IOCRMVOL = 0x40046f01 + UBI_IOCRNVOL = 0x51106f03 + UBI_IOCRPEB = 0x40046f04 + UBI_IOCRSVOL = 0x400c6f02 + UBI_IOCSETVOLPROP = 0x40104f06 + UBI_IOCSPEB = 0x40046f05 + UBI_IOCVOLCRBLK = 0x40804f07 + UBI_IOCVOLRMBLK = 0x4f08 + UBI_IOCVOLUP = 0x40084f00 + VDISCARD = 0xd + VEOF = 0x4 + VEOL = 0xb + VEOL2 = 0x10 + VMIN = 0x6 + VREPRINT = 0xc + VSTART = 0x8 + VSTOP = 0x9 + VSUSP = 0xa + VSWTC = 0x7 + VT1 = 0x4000 + VTDLY = 0x4000 + VTIME = 0x5 + VWERASE = 0xe + WDIOC_GETBOOTSTATUS = 0x80045702 + WDIOC_GETPRETIMEOUT = 0x80045709 + WDIOC_GETSTATUS = 0x80045701 + WDIOC_GETSUPPORT = 0x80285700 + WDIOC_GETTEMP = 0x80045703 + WDIOC_GETTIMELEFT = 0x8004570a + WDIOC_GETTIMEOUT = 0x80045707 + WDIOC_KEEPALIVE = 0x80045705 + WDIOC_SETOPTIONS = 0x80045704 + WORDSIZE = 0x40 + XCASE = 0x4 + XTABS = 0x1800 + _HIDIOCGRAWNAME = 0x80804804 + _HIDIOCGRAWPHYS = 0x80404805 + _HIDIOCGRAWUNIQ = 0x80404808 +) + +// Errors +const ( + EADDRINUSE = syscall.Errno(0x62) + EADDRNOTAVAIL = syscall.Errno(0x63) + EADV = syscall.Errno(0x44) + EAFNOSUPPORT = syscall.Errno(0x61) + EALREADY = syscall.Errno(0x72) + EBADE = syscall.Errno(0x34) + EBADFD = syscall.Errno(0x4d) + EBADMSG = syscall.Errno(0x4a) + EBADR = syscall.Errno(0x35) + EBADRQC = syscall.Errno(0x38) + EBADSLT = syscall.Errno(0x39) + EBFONT = syscall.Errno(0x3b) + ECANCELED = syscall.Errno(0x7d) + ECHRNG = syscall.Errno(0x2c) + ECOMM = syscall.Errno(0x46) + ECONNABORTED = syscall.Errno(0x67) + ECONNREFUSED = syscall.Errno(0x6f) + ECONNRESET = syscall.Errno(0x68) + EDEADLK = syscall.Errno(0x23) + EDEADLOCK = syscall.Errno(0x23) + EDESTADDRREQ = syscall.Errno(0x59) + EDOTDOT = syscall.Errno(0x49) + EDQUOT = syscall.Errno(0x7a) + EHOSTDOWN = syscall.Errno(0x70) + EHOSTUNREACH = syscall.Errno(0x71) + EHWPOISON = syscall.Errno(0x85) + EIDRM = syscall.Errno(0x2b) + EILSEQ = syscall.Errno(0x54) + EINPROGRESS = syscall.Errno(0x73) + EISCONN = syscall.Errno(0x6a) + EISNAM = syscall.Errno(0x78) + EKEYEXPIRED = syscall.Errno(0x7f) + EKEYREJECTED = syscall.Errno(0x81) + EKEYREVOKED = syscall.Errno(0x80) + EL2HLT = syscall.Errno(0x33) + EL2NSYNC = syscall.Errno(0x2d) + EL3HLT = syscall.Errno(0x2e) + EL3RST = syscall.Errno(0x2f) + ELIBACC = syscall.Errno(0x4f) + ELIBBAD = syscall.Errno(0x50) + ELIBEXEC = syscall.Errno(0x53) + ELIBMAX = syscall.Errno(0x52) + ELIBSCN = syscall.Errno(0x51) + ELNRNG = syscall.Errno(0x30) + ELOOP = syscall.Errno(0x28) + EMEDIUMTYPE = syscall.Errno(0x7c) + EMSGSIZE = syscall.Errno(0x5a) + EMULTIHOP = syscall.Errno(0x48) + ENAMETOOLONG = syscall.Errno(0x24) + ENAVAIL = syscall.Errno(0x77) + ENETDOWN = syscall.Errno(0x64) + ENETRESET = syscall.Errno(0x66) + ENETUNREACH = syscall.Errno(0x65) + ENOANO = syscall.Errno(0x37) + ENOBUFS = syscall.Errno(0x69) + ENOCSI = syscall.Errno(0x32) + ENODATA = syscall.Errno(0x3d) + ENOKEY = syscall.Errno(0x7e) + ENOLCK = syscall.Errno(0x25) + ENOLINK = syscall.Errno(0x43) + ENOMEDIUM = syscall.Errno(0x7b) + ENOMSG = syscall.Errno(0x2a) + ENONET = syscall.Errno(0x40) + ENOPKG = syscall.Errno(0x41) + ENOPROTOOPT = syscall.Errno(0x5c) + ENOSR = syscall.Errno(0x3f) + ENOSTR = syscall.Errno(0x3c) + ENOSYS = syscall.Errno(0x26) + ENOTCONN = syscall.Errno(0x6b) + ENOTEMPTY = syscall.Errno(0x27) + ENOTNAM = syscall.Errno(0x76) + ENOTRECOVERABLE = syscall.Errno(0x83) + ENOTSOCK = syscall.Errno(0x58) + ENOTSUP = syscall.Errno(0x5f) + ENOTUNIQ = syscall.Errno(0x4c) + EOPNOTSUPP = syscall.Errno(0x5f) + EOVERFLOW = syscall.Errno(0x4b) + EOWNERDEAD = syscall.Errno(0x82) + EPFNOSUPPORT = syscall.Errno(0x60) + EPROTO = syscall.Errno(0x47) + EPROTONOSUPPORT = syscall.Errno(0x5d) + EPROTOTYPE = syscall.Errno(0x5b) + EREMCHG = syscall.Errno(0x4e) + EREMOTE = syscall.Errno(0x42) + EREMOTEIO = syscall.Errno(0x79) + ERESTART = syscall.Errno(0x55) + ERFKILL = syscall.Errno(0x84) + ESHUTDOWN = syscall.Errno(0x6c) + ESOCKTNOSUPPORT = syscall.Errno(0x5e) + ESRMNT = syscall.Errno(0x45) + ESTALE = syscall.Errno(0x74) + ESTRPIPE = syscall.Errno(0x56) + ETIME = syscall.Errno(0x3e) + ETIMEDOUT = syscall.Errno(0x6e) + ETOOMANYREFS = syscall.Errno(0x6d) + EUCLEAN = syscall.Errno(0x75) + EUNATCH = syscall.Errno(0x31) + EUSERS = syscall.Errno(0x57) + EXFULL = syscall.Errno(0x36) +) + +// Signals +const ( + SIGBUS = syscall.Signal(0x7) + SIGCHLD = syscall.Signal(0x11) + SIGCLD = syscall.Signal(0x11) + SIGCONT = syscall.Signal(0x12) + SIGIO = syscall.Signal(0x1d) + SIGPOLL = syscall.Signal(0x1d) + SIGPROF = syscall.Signal(0x1b) + SIGPWR = syscall.Signal(0x1e) + SIGSTKFLT = syscall.Signal(0x10) + SIGSTOP = syscall.Signal(0x13) + SIGSYS = syscall.Signal(0x1f) + SIGTSTP = syscall.Signal(0x14) + SIGTTIN = syscall.Signal(0x15) + SIGTTOU = syscall.Signal(0x16) + SIGURG = syscall.Signal(0x17) + SIGUSR1 = syscall.Signal(0xa) + SIGUSR2 = syscall.Signal(0xc) + SIGVTALRM = syscall.Signal(0x1a) + SIGWINCH = syscall.Signal(0x1c) + SIGXCPU = syscall.Signal(0x18) + SIGXFSZ = syscall.Signal(0x19) +) + +// Error table +var errorList = [...]struct { + num syscall.Errno + name string + desc string +}{ + {1, "EPERM", "operation not permitted"}, + {2, "ENOENT", "no such file or directory"}, + {3, "ESRCH", "no such process"}, + {4, "EINTR", "interrupted system call"}, + {5, "EIO", "input/output error"}, + {6, "ENXIO", "no such device or address"}, + {7, "E2BIG", "argument list too long"}, + {8, "ENOEXEC", "exec format error"}, + {9, "EBADF", "bad file descriptor"}, + {10, "ECHILD", "no child processes"}, + {11, "EAGAIN", "resource temporarily unavailable"}, + {12, "ENOMEM", "cannot allocate memory"}, + {13, "EACCES", "permission denied"}, + {14, "EFAULT", "bad address"}, + {15, "ENOTBLK", "block device required"}, + {16, "EBUSY", "device or resource busy"}, + {17, "EEXIST", "file exists"}, + {18, "EXDEV", "invalid cross-device link"}, + {19, "ENODEV", "no such device"}, + {20, "ENOTDIR", "not a directory"}, + {21, "EISDIR", "is a directory"}, + {22, "EINVAL", "invalid argument"}, + {23, "ENFILE", "too many open files in system"}, + {24, "EMFILE", "too many open files"}, + {25, "ENOTTY", "inappropriate ioctl for device"}, + {26, "ETXTBSY", "text file busy"}, + {27, "EFBIG", "file too large"}, + {28, "ENOSPC", "no space left on device"}, + {29, "ESPIPE", "illegal seek"}, + {30, "EROFS", "read-only file system"}, + {31, "EMLINK", "too many links"}, + {32, "EPIPE", "broken pipe"}, + {33, "EDOM", "numerical argument out of domain"}, + {34, "ERANGE", "numerical result out of range"}, + {35, "EDEADLK", "resource deadlock avoided"}, + {36, "ENAMETOOLONG", "file name too long"}, + {37, "ENOLCK", "no locks available"}, + {38, "ENOSYS", "function not implemented"}, + {39, "ENOTEMPTY", "directory not empty"}, + {40, "ELOOP", "too many levels of symbolic links"}, + {42, "ENOMSG", "no message of desired type"}, + {43, "EIDRM", "identifier removed"}, + {44, "ECHRNG", "channel number out of range"}, + {45, "EL2NSYNC", "level 2 not synchronized"}, + {46, "EL3HLT", "level 3 halted"}, + {47, "EL3RST", "level 3 reset"}, + {48, "ELNRNG", "link number out of range"}, + {49, "EUNATCH", "protocol driver not attached"}, + {50, "ENOCSI", "no CSI structure available"}, + {51, "EL2HLT", "level 2 halted"}, + {52, "EBADE", "invalid exchange"}, + {53, "EBADR", "invalid request descriptor"}, + {54, "EXFULL", "exchange full"}, + {55, "ENOANO", "no anode"}, + {56, "EBADRQC", "invalid request code"}, + {57, "EBADSLT", "invalid slot"}, + {59, "EBFONT", "bad font file format"}, + {60, "ENOSTR", "device not a stream"}, + {61, "ENODATA", "no data available"}, + {62, "ETIME", "timer expired"}, + {63, "ENOSR", "out of streams resources"}, + {64, "ENONET", "machine is not on the network"}, + {65, "ENOPKG", "package not installed"}, + {66, "EREMOTE", "object is remote"}, + {67, "ENOLINK", "link has been severed"}, + {68, "EADV", "advertise error"}, + {69, "ESRMNT", "srmount error"}, + {70, "ECOMM", "communication error on send"}, + {71, "EPROTO", "protocol error"}, + {72, "EMULTIHOP", "multihop attempted"}, + {73, "EDOTDOT", "RFS specific error"}, + {74, "EBADMSG", "bad message"}, + {75, "EOVERFLOW", "value too large for defined data type"}, + {76, "ENOTUNIQ", "name not unique on network"}, + {77, "EBADFD", "file descriptor in bad state"}, + {78, "EREMCHG", "remote address changed"}, + {79, "ELIBACC", "can not access a needed shared library"}, + {80, "ELIBBAD", "accessing a corrupted shared library"}, + {81, "ELIBSCN", ".lib section in a.out corrupted"}, + {82, "ELIBMAX", "attempting to link in too many shared libraries"}, + {83, "ELIBEXEC", "cannot exec a shared library directly"}, + {84, "EILSEQ", "invalid or incomplete multibyte or wide character"}, + {85, "ERESTART", "interrupted system call should be restarted"}, + {86, "ESTRPIPE", "streams pipe error"}, + {87, "EUSERS", "too many users"}, + {88, "ENOTSOCK", "socket operation on non-socket"}, + {89, "EDESTADDRREQ", "destination address required"}, + {90, "EMSGSIZE", "message too long"}, + {91, "EPROTOTYPE", "protocol wrong type for socket"}, + {92, "ENOPROTOOPT", "protocol not available"}, + {93, "EPROTONOSUPPORT", "protocol not supported"}, + {94, "ESOCKTNOSUPPORT", "socket type not supported"}, + {95, "ENOTSUP", "operation not supported"}, + {96, "EPFNOSUPPORT", "protocol family not supported"}, + {97, "EAFNOSUPPORT", "address family not supported by protocol"}, + {98, "EADDRINUSE", "address already in use"}, + {99, "EADDRNOTAVAIL", "cannot assign requested address"}, + {100, "ENETDOWN", "network is down"}, + {101, "ENETUNREACH", "network is unreachable"}, + {102, "ENETRESET", "network dropped connection on reset"}, + {103, "ECONNABORTED", "software caused connection abort"}, + {104, "ECONNRESET", "connection reset by peer"}, + {105, "ENOBUFS", "no buffer space available"}, + {106, "EISCONN", "transport endpoint is already connected"}, + {107, "ENOTCONN", "transport endpoint is not connected"}, + {108, "ESHUTDOWN", "cannot send after transport endpoint shutdown"}, + {109, "ETOOMANYREFS", "too many references: cannot splice"}, + {110, "ETIMEDOUT", "connection timed out"}, + {111, "ECONNREFUSED", "connection refused"}, + {112, "EHOSTDOWN", "host is down"}, + {113, "EHOSTUNREACH", "no route to host"}, + {114, "EALREADY", "operation already in progress"}, + {115, "EINPROGRESS", "operation now in progress"}, + {116, "ESTALE", "stale file handle"}, + {117, "EUCLEAN", "structure needs cleaning"}, + {118, "ENOTNAM", "not a XENIX named type file"}, + {119, "ENAVAIL", "no XENIX semaphores available"}, + {120, "EISNAM", "is a named type file"}, + {121, "EREMOTEIO", "remote I/O error"}, + {122, "EDQUOT", "disk quota exceeded"}, + {123, "ENOMEDIUM", "no medium found"}, + {124, "EMEDIUMTYPE", "wrong medium type"}, + {125, "ECANCELED", "operation canceled"}, + {126, "ENOKEY", "required key not available"}, + {127, "EKEYEXPIRED", "key has expired"}, + {128, "EKEYREVOKED", "key has been revoked"}, + {129, "EKEYREJECTED", "key was rejected by service"}, + {130, "EOWNERDEAD", "owner died"}, + {131, "ENOTRECOVERABLE", "state not recoverable"}, + {132, "ERFKILL", "operation not possible due to RF-kill"}, + {133, "EHWPOISON", "memory page has hardware error"}, +} + +// Signal table +var signalList = [...]struct { + num syscall.Signal + name string + desc string +}{ + {1, "SIGHUP", "hangup"}, + {2, "SIGINT", "interrupt"}, + {3, "SIGQUIT", "quit"}, + {4, "SIGILL", "illegal instruction"}, + {5, "SIGTRAP", "trace/breakpoint trap"}, + {6, "SIGABRT", "aborted"}, + {7, "SIGBUS", "bus error"}, + {8, "SIGFPE", "floating point exception"}, + {9, "SIGKILL", "killed"}, + {10, "SIGUSR1", "user defined signal 1"}, + {11, "SIGSEGV", "segmentation fault"}, + {12, "SIGUSR2", "user defined signal 2"}, + {13, "SIGPIPE", "broken pipe"}, + {14, "SIGALRM", "alarm clock"}, + {15, "SIGTERM", "terminated"}, + {16, "SIGSTKFLT", "stack fault"}, + {17, "SIGCHLD", "child exited"}, + {18, "SIGCONT", "continued"}, + {19, "SIGSTOP", "stopped (signal)"}, + {20, "SIGTSTP", "stopped"}, + {21, "SIGTTIN", "stopped (tty input)"}, + {22, "SIGTTOU", "stopped (tty output)"}, + {23, "SIGURG", "urgent I/O condition"}, + {24, "SIGXCPU", "CPU time limit exceeded"}, + {25, "SIGXFSZ", "file size limit exceeded"}, + {26, "SIGVTALRM", "virtual timer expired"}, + {27, "SIGPROF", "profiling timer expired"}, + {28, "SIGWINCH", "window changed"}, + {29, "SIGIO", "I/O possible"}, + {30, "SIGPWR", "power failure"}, + {31, "SIGSYS", "bad system call"}, +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index a8bba949..bd794e01 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -5,7 +5,7 @@ // +build mips,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -250,6 +250,8 @@ const ( RTC_EPOCH_SET = 0x8004700e RTC_IRQP_READ = 0x4004700b RTC_IRQP_SET = 0x8004700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x401c7011 @@ -324,9 +326,11 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_RXQ_OVFL = 0x28 @@ -348,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index ee9e7e20..6c741b05 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -5,7 +5,7 @@ // +build mips64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -250,6 +250,8 @@ const ( RTC_EPOCH_SET = 0x8008700e RTC_IRQP_READ = 0x4008700b RTC_IRQP_SET = 0x8008700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x40207011 @@ -324,9 +326,11 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_RXQ_OVFL = 0x28 @@ -348,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index ba4b288a..807b8cd2 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -5,7 +5,7 @@ // +build mips64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -250,6 +250,8 @@ const ( RTC_EPOCH_SET = 0x8008700e RTC_IRQP_READ = 0x4008700b RTC_IRQP_SET = 0x8008700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x40207011 @@ -324,9 +326,11 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_RXQ_OVFL = 0x28 @@ -348,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index bc93afc3..a39e4f5c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -5,7 +5,7 @@ // +build mipsle,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -250,6 +250,8 @@ const ( RTC_EPOCH_SET = 0x8004700e RTC_IRQP_READ = 0x4004700b RTC_IRQP_SET = 0x8004700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x401c7011 @@ -324,9 +326,11 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_RXQ_OVFL = 0x28 @@ -348,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index 9295e694..c0fcda86 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -5,7 +5,7 @@ // +build ppc,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -305,6 +305,8 @@ const ( RTC_EPOCH_SET = 0x8004700e RTC_IRQP_READ = 0x4004700b RTC_IRQP_SET = 0x8004700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x401c7011 @@ -379,9 +381,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x10 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x12 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x12 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -402,6 +406,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 1fa081c9..f3b72407 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -5,7 +5,7 @@ // +build ppc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -309,6 +309,8 @@ const ( RTC_EPOCH_SET = 0x8008700e RTC_IRQP_READ = 0x4008700b RTC_IRQP_SET = 0x8008700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x40207011 @@ -383,9 +385,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x10 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x12 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x12 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -406,6 +410,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 74b32114..72f2a45d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -5,7 +5,7 @@ // +build ppc64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -309,6 +309,8 @@ const ( RTC_EPOCH_SET = 0x8008700e RTC_IRQP_READ = 0x4008700b RTC_IRQP_SET = 0x8008700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x40207011 @@ -383,9 +385,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x10 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x12 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x12 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -406,6 +410,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index c91c8ac5..45b214b4 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -5,7 +5,7 @@ // +build riscv64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -238,6 +238,8 @@ const ( RTC_EPOCH_SET = 0x4008700e RTC_IRQP_READ = 0x8008700b RTC_IRQP_SET = 0x4008700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 RTC_PIE_OFF = 0x7006 RTC_PIE_ON = 0x7005 RTC_PLL_GET = 0x80207011 @@ -312,9 +314,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -335,6 +339,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index b66bf222..1897f207 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -5,7 +5,7 @@ // +build s390x,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char _const.go package unix @@ -313,6 +313,8 @@ const ( RTC_EPOCH_SET = 0x4008700e RTC_IRQP_READ = 0x8008700b RTC_IRQP_SET = 0x4008700c + RTC_PARAM_GET = 0x40187013 + RTC_PARAM_SET = 0x40187014 RTC_PIE_OFF = 0x7006 RTC_PIE_ON = 0x7005 RTC_PLL_GET = 0x80207011 @@ -387,9 +389,11 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 + SO_RESERVE_MEM = 0x49 SO_REUSEADDR = 0x2 SO_REUSEPORT = 0xf SO_RXQ_OVFL = 0x28 @@ -410,6 +414,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f7fb149b..1fb7a395 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -5,7 +5,7 @@ // +build sparc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -304,6 +304,8 @@ const ( RTC_EPOCH_SET = 0x8008700e RTC_IRQP_READ = 0x4008700b RTC_IRQP_SET = 0x8008700c + RTC_PARAM_GET = 0x80187013 + RTC_PARAM_SET = 0x80187014 RTC_PIE_OFF = 0x20007006 RTC_PIE_ON = 0x20007005 RTC_PLL_GET = 0x40207011 @@ -378,9 +380,11 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x100b SO_RCVLOWAT = 0x800 + SO_RCVMARK = 0x54 SO_RCVTIMEO = 0x2000 SO_RCVTIMEO_NEW = 0x44 SO_RCVTIMEO_OLD = 0x2000 + SO_RESERVE_MEM = 0x52 SO_REUSEADDR = 0x4 SO_REUSEPORT = 0x200 SO_RXQ_OVFL = 0x24 @@ -401,6 +405,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x42 SO_TIMESTAMPNS_OLD = 0x21 SO_TIMESTAMP_NEW = 0x46 + SO_TXREHASH = 0x53 SO_TXTIME = 0x3f SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x25 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index 85e0cc38..870215d2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -975,7 +975,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 *byte if len(p) > 0 { _p0 = &p[0] @@ -992,7 +992,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 *byte if len(p) > 0 { _p0 = &p[0] diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index f1d4a73b..a89b0bfa 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -931,7 +931,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 *byte if len(p) > 0 { _p0 = &p[0] @@ -946,7 +946,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 *byte if len(p) > 0 { _p0 = &p[0] diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 0ae0ed4c..467deed7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -643,17 +643,22 @@ var libc_flistxattr_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setattrlist(path *byte, list unsafe.Pointer, buf unsafe.Pointer, size uintptr, options int) (err error) { - _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(list), uintptr(buf), uintptr(size), uintptr(options), 0) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } -var libc_setattrlist_trampoline_addr uintptr +var libc_utimensat_trampoline_addr uintptr -//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" +//go:cgo_import_dynamic libc_utimensat utimensat "/usr/lib/libSystem.B.dylib" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -1638,6 +1643,30 @@ var libc_mknod_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fsType) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(dir) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(flags), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mount mount "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Open(path string, mode int, perm uint32) (fd int, err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -1698,7 +1727,7 @@ var libc_pathconf_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1719,7 +1748,7 @@ var libc_pread_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index eac6ca80..7e308a47 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -228,11 +228,11 @@ TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) -TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setattrlist(SB) +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) -GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) @@ -600,6 +600,12 @@ TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) +TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mount(SB) + +GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) + TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index cf71be3e..35938d34 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -643,17 +643,22 @@ var libc_flistxattr_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setattrlist(path *byte, list unsafe.Pointer, buf unsafe.Pointer, size uintptr, options int) (err error) { - _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(list), uintptr(buf), uintptr(size), uintptr(options), 0) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_utimensat_trampoline_addr, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } return } -var libc_setattrlist_trampoline_addr uintptr +var libc_utimensat_trampoline_addr uintptr -//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" +//go:cgo_import_dynamic libc_utimensat utimensat "/usr/lib/libSystem.B.dylib" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -1638,6 +1643,30 @@ var libc_mknod_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fsType) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(dir) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(flags), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mount mount "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Open(path string, mode int, perm uint32) (fd int, err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -1698,7 +1727,7 @@ var libc_pathconf_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1719,7 +1748,7 @@ var libc_pread_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index 4ebcf217..b09e5bb0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -228,11 +228,11 @@ TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) -TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setattrlist(SB) +TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_utimensat(SB) -GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) +GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) @@ -600,6 +600,12 @@ TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) +TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mount(SB) + +GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) + TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index 3e9bddb7..039c4aa0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -912,7 +912,7 @@ func Fpathconf(fd int, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat(fd int, stat *stat_freebsd11_t) (err error) { +func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -922,17 +922,7 @@ func fstat(fd int, stat *stat_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat_freebsd12(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) { +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -947,22 +937,7 @@ func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatat_freebsd12(fd int, path string, stat *Stat_t, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_FSTATAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { +func Fstatfs(fd int, stat *Statfs_t) (err error) { _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -972,16 +947,6 @@ func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatfs_freebsd12(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fsync(fd int) (err error) { _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) if e1 != 0 { @@ -1002,7 +967,7 @@ func Ftruncate(fd int, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { +func getdirentries(fd int, buf []byte, basep *uint64) (n int, err error) { var _p0 unsafe.Pointer if len(buf) > 0 { _p0 = unsafe.Pointer(&buf[0]) @@ -1019,23 +984,6 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) { - var _p0 unsafe.Pointer - if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_GETDIRENTRIES_FREEBSD12, uintptr(fd), uintptr(_p0), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Getdtablesize() (size int) { r0, _, _ := Syscall(SYS_GETDTABLESIZE, 0, 0, 0) size = int(r0) @@ -1257,21 +1205,6 @@ func Listen(s int, backlog int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func lstat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Mkdir(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -1317,43 +1250,13 @@ func Mkfifo(path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mknod(path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func mknodat(fd int, path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func mknodat_freebsd12(fd int, path string, mode uint32, dev uint64) (err error) { +func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), uintptr(dev>>32), 0) + _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), uintptr(dev>>32), 0) if e1 != 0 { err = errnoErr(e1) } @@ -1420,7 +1323,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1437,7 +1340,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1753,22 +1656,7 @@ func Setuid(uid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func stat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func statfs(path string, stat *statfs_freebsd11_t) (err error) { +func Statfs(path string, stat *Statfs_t) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -1783,21 +1671,6 @@ func statfs(path string, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func statfs_freebsd12(path string, stat *Statfs_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STATFS_FREEBSD12, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Symlink(path string, link string) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index c72a462b..0535d3cf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -912,7 +912,7 @@ func Fpathconf(fd int, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat(fd int, stat *stat_freebsd11_t) (err error) { +func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -922,17 +922,7 @@ func fstat(fd int, stat *stat_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat_freebsd12(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) { +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -947,22 +937,7 @@ func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatat_freebsd12(fd int, path string, stat *Stat_t, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_FSTATAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { +func Fstatfs(fd int, stat *Statfs_t) (err error) { _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -972,16 +947,6 @@ func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatfs_freebsd12(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fsync(fd int) (err error) { _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) if e1 != 0 { @@ -1002,7 +967,7 @@ func Ftruncate(fd int, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { +func getdirentries(fd int, buf []byte, basep *uint64) (n int, err error) { var _p0 unsafe.Pointer if len(buf) > 0 { _p0 = unsafe.Pointer(&buf[0]) @@ -1019,23 +984,6 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) { - var _p0 unsafe.Pointer - if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_GETDIRENTRIES_FREEBSD12, uintptr(fd), uintptr(_p0), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Getdtablesize() (size int) { r0, _, _ := Syscall(SYS_GETDTABLESIZE, 0, 0, 0) size = int(r0) @@ -1257,21 +1205,6 @@ func Listen(s int, backlog int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func lstat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Mkdir(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -1317,22 +1250,7 @@ func Mkfifo(path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mknod(path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func mknodat(fd int, path string, mode uint32, dev int) (err error) { +func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -1347,21 +1265,6 @@ func mknodat(fd int, path string, mode uint32, dev int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mknodat_freebsd12(fd int, path string, mode uint32, dev uint64) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_MKNODAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { @@ -1420,7 +1323,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1437,7 +1340,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1753,22 +1656,7 @@ func Setuid(uid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func stat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func statfs(path string, stat *statfs_freebsd11_t) (err error) { +func Statfs(path string, stat *Statfs_t) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -1783,21 +1671,6 @@ func statfs(path string, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func statfs_freebsd12(path string, stat *Statfs_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STATFS_FREEBSD12, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Symlink(path string, link string) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index 530d5df9..1018b522 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -351,22 +351,6 @@ func Munlockall() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { - var _p0 unsafe.Pointer - if len(mib) > 0 { - _p0 = unsafe.Pointer(&mib[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func pipe2(p *[2]_C_int, flags int) (err error) { _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) if e1 != 0 { @@ -404,6 +388,22 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ptrace(request int, pid int, addr uintptr, data int) (err error) { _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) if e1 != 0 { @@ -912,7 +912,7 @@ func Fpathconf(fd int, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat(fd int, stat *stat_freebsd11_t) (err error) { +func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -922,17 +922,7 @@ func fstat(fd int, stat *stat_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat_freebsd12(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) { +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -947,22 +937,7 @@ func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatat_freebsd12(fd int, path string, stat *Stat_t, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_FSTATAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { +func Fstatfs(fd int, stat *Statfs_t) (err error) { _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -972,16 +947,6 @@ func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatfs_freebsd12(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fsync(fd int) (err error) { _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) if e1 != 0 { @@ -1002,7 +967,7 @@ func Ftruncate(fd int, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { +func getdirentries(fd int, buf []byte, basep *uint64) (n int, err error) { var _p0 unsafe.Pointer if len(buf) > 0 { _p0 = unsafe.Pointer(&buf[0]) @@ -1019,23 +984,6 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) { - var _p0 unsafe.Pointer - if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_GETDIRENTRIES_FREEBSD12, uintptr(fd), uintptr(_p0), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Getdtablesize() (size int) { r0, _, _ := Syscall(SYS_GETDTABLESIZE, 0, 0, 0) size = int(r0) @@ -1257,21 +1205,6 @@ func Listen(s int, backlog int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func lstat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Mkdir(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -1317,43 +1250,13 @@ func Mkfifo(path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mknod(path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func mknodat(fd int, path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func mknodat_freebsd12(fd int, path string, mode uint32, dev uint64) (err error) { +func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { return } - _, _, e1 := Syscall6(SYS_MKNODAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, uintptr(dev), uintptr(dev>>32)) if e1 != 0 { err = errnoErr(e1) } @@ -1420,7 +1323,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1437,7 +1340,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1753,22 +1656,7 @@ func Setuid(uid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func stat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func statfs(path string, stat *statfs_freebsd11_t) (err error) { +func Statfs(path string, stat *Statfs_t) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -1783,21 +1671,6 @@ func statfs(path string, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func statfs_freebsd12(path string, stat *Statfs_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STATFS_FREEBSD12, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Symlink(path string, link string) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index 71e7df9e..3802f4b3 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -912,7 +912,7 @@ func Fpathconf(fd int, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat(fd int, stat *stat_freebsd11_t) (err error) { +func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -922,17 +922,7 @@ func fstat(fd int, stat *stat_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstat_freebsd12(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) { +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -947,22 +937,7 @@ func fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatat_freebsd12(fd int, path string, stat *Stat_t, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_FSTATAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { +func Fstatfs(fd int, stat *Statfs_t) (err error) { _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { err = errnoErr(e1) @@ -972,16 +947,6 @@ func fstatfs(fd int, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func fstatfs_freebsd12(fd int, stat *Statfs_t) (err error) { - _, _, e1 := Syscall(SYS_FSTATFS_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fsync(fd int) (err error) { _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) if e1 != 0 { @@ -1002,7 +967,7 @@ func Ftruncate(fd int, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { +func getdirentries(fd int, buf []byte, basep *uint64) (n int, err error) { var _p0 unsafe.Pointer if len(buf) > 0 { _p0 = unsafe.Pointer(&buf[0]) @@ -1019,23 +984,6 @@ func getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error) { - var _p0 unsafe.Pointer - if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_GETDIRENTRIES_FREEBSD12, uintptr(fd), uintptr(_p0), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Getdtablesize() (size int) { r0, _, _ := Syscall(SYS_GETDTABLESIZE, 0, 0, 0) size = int(r0) @@ -1257,21 +1205,6 @@ func Listen(s int, backlog int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func lstat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_LSTAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Mkdir(path string, mode uint32) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) @@ -1317,22 +1250,7 @@ func Mkfifo(path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mknod(path string, mode uint32, dev int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_MKNOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev)) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func mknodat(fd int, path string, mode uint32, dev int) (err error) { +func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -1347,21 +1265,6 @@ func mknodat(fd int, path string, mode uint32, dev int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func mknodat_freebsd12(fd int, path string, mode uint32, dev uint64) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_MKNODAT_FREEBSD12, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { @@ -1420,7 +1323,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1437,7 +1340,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1753,22 +1656,7 @@ func Setuid(uid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func stat(path string, stat *stat_freebsd11_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STAT, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func statfs(path string, stat *statfs_freebsd11_t) (err error) { +func Statfs(path string, stat *Statfs_t) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) if err != nil { @@ -1783,21 +1671,6 @@ func statfs(path string, stat *statfs_freebsd11_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func statfs_freebsd12(path string, stat *Statfs_t) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall(SYS_STATFS_FREEBSD12, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Symlink(path string, link string) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go new file mode 100644 index 00000000..8a2db7da --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -0,0 +1,1889 @@ +// go run mksyscall.go -tags freebsd,riscv64 syscall_bsd.go syscall_freebsd.go syscall_freebsd_riscv64.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build freebsd && riscv64 +// +build freebsd,riscv64 + +package unix + +import ( + "syscall" + "unsafe" +) + +var _ syscall.Errno + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getgroups(ngid int, gid *_Gid_t) (n int, err error) { + r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setgroups(ngid int, gid *_Gid_t) (err error) { + _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err error) { + r0, _, e1 := Syscall6(SYS_WAIT4, uintptr(pid), uintptr(unsafe.Pointer(wstatus)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) + wpid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { + r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socket(domain int, typ int, proto int) (fd int, err error) { + r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { + _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { + _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Shutdown(s int, how int) (err error) { + _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(s), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { + _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func kevent(kq int, change unsafe.Pointer, nchange int, event unsafe.Pointer, nevent int, timeout *Timespec) (n int, err error) { + r0, _, e1 := Syscall6(SYS_KEVENT, uintptr(kq), uintptr(change), uintptr(nchange), uintptr(event), uintptr(nevent), uintptr(unsafe.Pointer(timeout))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimes(path string, timeval *[2]Timeval) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_UTIMES, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func futimes(fd int, timeval *[2]Timeval) (err error) { + _, _, e1 := Syscall(SYS_FUTIMES, uintptr(fd), uintptr(unsafe.Pointer(timeval)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { + r0, _, e1 := Syscall(SYS_POLL, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Madvise(b []byte, behav int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall(SYS_MADVISE, uintptr(_p0), uintptr(len(b)), uintptr(behav)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall(SYS_MLOCK, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mlockall(flags int) (err error) { + _, _, e1 := Syscall(SYS_MLOCKALL, uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mprotect(b []byte, prot int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall(SYS_MPROTECT, uintptr(_p0), uintptr(len(b)), uintptr(prot)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Msync(b []byte, flags int) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall(SYS_MSYNC, uintptr(_p0), uintptr(len(b)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlock(b []byte) (err error) { + var _p0 unsafe.Pointer + if len(b) > 0 { + _p0 = unsafe.Pointer(&b[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall(SYS_MUNLOCK, uintptr(_p0), uintptr(len(b)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Munlockall() (err error) { + _, _, e1 := Syscall(SYS_MUNLOCKALL, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pipe2(p *[2]_C_int, flags int) (err error) { + _, _, e1 := RawSyscall(SYS_PIPE2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getcwd(buf []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall(SYS___GETCWD, uintptr(_p0), uintptr(len(buf)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctl(fd int, req uint, arg uintptr) (err error) { + _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS___SYSCTL, uintptr(_p0), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ptrace(request int, pid int, addr uintptr, data int) (err error) { + _, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Access(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_ACCESS, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { + _, _, e1 := Syscall(SYS_ADJTIME, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func CapEnter() (err error) { + _, _, e1 := Syscall(SYS_CAP_ENTER, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func capRightsGet(version int, fd int, rightsp *CapRights) (err error) { + _, _, e1 := Syscall(SYS___CAP_RIGHTS_GET, uintptr(version), uintptr(fd), uintptr(unsafe.Pointer(rightsp))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func capRightsLimit(fd int, rightsp *CapRights) (err error) { + _, _, e1 := Syscall(SYS_CAP_RIGHTS_LIMIT, uintptr(fd), uintptr(unsafe.Pointer(rightsp)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_CHDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chflags(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_CHFLAGS, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chmod(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_CHMOD, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_CHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Chroot(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_CHROOT, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Close(fd int) (err error) { + _, _, e1 := Syscall(SYS_CLOSE, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup(fd int) (nfd int, err error) { + r0, _, e1 := Syscall(SYS_DUP, uintptr(fd), 0, 0) + nfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Dup2(from int, to int) (err error) { + _, _, e1 := Syscall(SYS_DUP2, uintptr(from), uintptr(to), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Exit(code int) { + Syscall(SYS_EXIT, uintptr(code), 0, 0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrGetFd(fd int, attrnamespace int, attrname string, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(attrname) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_GET_FD, uintptr(fd), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p0)), uintptr(data), uintptr(nbytes), 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrSetFd(fd int, attrnamespace int, attrname string, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(attrname) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_SET_FD, uintptr(fd), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p0)), uintptr(data), uintptr(nbytes), 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrDeleteFd(fd int, attrnamespace int, attrname string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(attrname) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_EXTATTR_DELETE_FD, uintptr(fd), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p0))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrListFd(fd int, attrnamespace int, data uintptr, nbytes int) (ret int, err error) { + r0, _, e1 := Syscall6(SYS_EXTATTR_LIST_FD, uintptr(fd), uintptr(attrnamespace), uintptr(data), uintptr(nbytes), 0, 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrGetFile(file string, attrnamespace int, attrname string, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(file) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attrname) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_GET_FILE, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p1)), uintptr(data), uintptr(nbytes), 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrSetFile(file string, attrnamespace int, attrname string, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(file) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attrname) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_SET_FILE, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p1)), uintptr(data), uintptr(nbytes), 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrDeleteFile(file string, attrnamespace int, attrname string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(file) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attrname) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_EXTATTR_DELETE_FILE, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrListFile(file string, attrnamespace int, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(file) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_LIST_FILE, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(data), uintptr(nbytes), 0, 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrGetLink(link string, attrnamespace int, attrname string, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(link) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attrname) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_GET_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p1)), uintptr(data), uintptr(nbytes), 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrSetLink(link string, attrnamespace int, attrname string, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(link) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attrname) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_SET_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p1)), uintptr(data), uintptr(nbytes), 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrDeleteLink(link string, attrnamespace int, attrname string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(link) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(attrname) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_EXTATTR_DELETE_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ExtattrListLink(link string, attrnamespace int, data uintptr, nbytes int) (ret int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(link) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_EXTATTR_LIST_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(attrnamespace), uintptr(data), uintptr(nbytes), 0, 0) + ret = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fadvise(fd int, offset int64, length int64, advice int) (err error) { + _, _, e1 := Syscall6(SYS_POSIX_FADVISE, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FACCESSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchdir(fd int) (err error) { + _, _, e1 := Syscall(SYS_FCHDIR, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchflags(fd int, flags int) (err error) { + _, _, e1 := Syscall(SYS_FCHFLAGS, uintptr(fd), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmod(fd int, mode uint32) (err error) { + _, _, e1 := Syscall(SYS_FCHMOD, uintptr(fd), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FCHMODAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FCHOWNAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Flock(fd int, how int) (err error) { + _, _, e1 := Syscall(SYS_FLOCK, uintptr(fd), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fpathconf(fd int, name int) (val int, err error) { + r0, _, e1 := Syscall(SYS_FPATHCONF, uintptr(fd), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstat(fd int, stat *Stat_t) (err error) { + _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatfs(fd int, stat *Statfs_t) (err error) { + _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsync(fd int) (err error) { + _, _, e1 := Syscall(SYS_FSYNC, uintptr(fd), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Ftruncate(fd int, length int64) (err error) { + _, _, e1 := Syscall(SYS_FTRUNCATE, uintptr(fd), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getdirentries(fd int, buf []byte, basep *uint64) (n int, err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_GETDIRENTRIES, uintptr(fd), uintptr(_p0), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getdtablesize() (size int) { + r0, _, _ := Syscall(SYS_GETDTABLESIZE, 0, 0, 0) + size = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + r0, _, _ := RawSyscall(SYS_GETEGID, 0, 0, 0) + egid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (uid int) { + r0, _, _ := RawSyscall(SYS_GETEUID, 0, 0, 0) + uid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _, _ := RawSyscall(SYS_GETGID, 0, 0, 0) + gid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgid(pid int) (pgid int, err error) { + r0, _, e1 := RawSyscall(SYS_GETPGID, uintptr(pid), 0, 0) + pgid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpgrp() (pgrp int) { + r0, _, _ := RawSyscall(SYS_GETPGRP, 0, 0, 0) + pgrp = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpid() (pid int) { + r0, _, _ := RawSyscall(SYS_GETPID, 0, 0, 0) + pid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getppid() (ppid int) { + r0, _, _ := RawSyscall(SYS_GETPPID, 0, 0, 0) + ppid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getpriority(which int, who int) (prio int, err error) { + r0, _, e1 := Syscall(SYS_GETPRIORITY, uintptr(which), uintptr(who), 0) + prio = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := RawSyscall(SYS_GETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getrusage(who int, rusage *Rusage) (err error) { + _, _, e1 := RawSyscall(SYS_GETRUSAGE, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := RawSyscall(SYS_GETSID, uintptr(pid), 0, 0) + sid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gettimeofday(tv *Timeval) (err error) { + _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _, _ := RawSyscall(SYS_GETUID, 0, 0, 0) + uid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Issetugid() (tainted bool) { + r0, _, _ := Syscall(SYS_ISSETUGID, 0, 0, 0) + tainted = bool(r0 != 0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kill(pid int, signum syscall.Signal) (err error) { + _, _, e1 := Syscall(SYS_KILL, uintptr(pid), uintptr(signum), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Kqueue() (fd int, err error) { + r0, _, e1 := Syscall(SYS_KQUEUE, 0, 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Lchown(path string, uid int, gid int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_LCHOWN, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Link(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_LINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_LINKAT, uintptr(pathfd), uintptr(unsafe.Pointer(_p0)), uintptr(linkfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, backlog int) (err error) { + _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(backlog), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdir(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_MKDIR, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkdirat(dirfd int, path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_MKDIRAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mkfifo(path string, mode uint32) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_MKFIFO, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_MKNODAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Nanosleep(time *Timespec, leftover *Timespec) (err error) { + _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Open(path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := Syscall(SYS_OPEN, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Openat(fdat int, path string, mode int, perm uint32) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := Syscall6(SYS_OPENAT, uintptr(fdat), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Pathconf(path string, name int) (val int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + r0, _, e1 := Syscall(SYS_PATHCONF, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0) + val = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_PREAD, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_PWRITE, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func read(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlink(path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall(SYS_READLINK, uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Readlinkat(dirfd int, path string, buf []byte) (n int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(buf) > 0 { + _p1 = unsafe.Pointer(&buf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_READLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(_p1), uintptr(len(buf)), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rename(from string, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_RENAME, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Renameat(fromfd int, from string, tofd int, to string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(from) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(to) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_RENAMEAT, uintptr(fromfd), uintptr(unsafe.Pointer(_p0)), uintptr(tofd), uintptr(unsafe.Pointer(_p1)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Revoke(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_REVOKE, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Rmdir(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_RMDIR, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { + r0, _, e1 := Syscall(SYS_LSEEK, uintptr(fd), uintptr(offset), uintptr(whence)) + newoffset = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) { + r0, _, e1 := Syscall6(SYS_SELECT, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setegid(egid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETEGID, uintptr(egid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seteuid(euid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETEUID, uintptr(euid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setgid(gid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETGID, uintptr(gid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setlogin(name string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(name) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_SETLOGIN, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpgid(pid int, pgid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETPGID, uintptr(pid), uintptr(pgid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setpriority(which int, who int, prio int) (err error) { + _, _, e1 := Syscall(SYS_SETPRIORITY, uintptr(which), uintptr(who), uintptr(prio)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setregid(rgid int, egid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setreuid(ruid int, euid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresgid(rgid int, egid int, sgid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresuid(ruid int, euid int, suid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setrlimit(which int, lim *Rlimit) (err error) { + _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setsid() (pid int, err error) { + r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) + pid = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Settimeofday(tp *Timeval) (err error) { + _, _, e1 := RawSyscall(SYS_SETTIMEOFDAY, uintptr(unsafe.Pointer(tp)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setuid(uid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETUID, uintptr(uid), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Statfs(path string, stat *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlink(path string, link string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(link) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_SYMLINK, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Symlinkat(oldpath string, newdirfd int, newpath string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(oldpath) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(newpath) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_SYMLINKAT, uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Sync() (err error) { + _, _, e1 := Syscall(SYS_SYNC, 0, 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Truncate(path string, length int64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Umask(newmask int) (oldmask int) { + r0, _, _ := Syscall(SYS_UMASK, uintptr(newmask), 0, 0) + oldmask = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Undelete(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_UNDELETE, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlink(path string) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_UNLINK, uintptr(unsafe.Pointer(_p0)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unlinkat(dirfd int, path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_UNLINKAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Unmount(path string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_UNMOUNT, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func write(fd int, p []byte) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(_p0), uintptr(len(p))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) + ret = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func munmap(addr uintptr, length uintptr) (err error) { + _, _, e1 := Syscall(SYS_MUNMAP, uintptr(addr), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func readlen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writelen(fd int, buf *byte, nbuf int) (n int, err error) { + r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { + r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) + nfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index 93edda4c..bc4a2753 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -231,6 +231,16 @@ func wait4(pid int, wstatus *_C_int, options int, rusage *Rusage) (wpid int, err // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Waitid(idType int, id int, info *Siginfo, options int, rusage *Rusage) (err error) { + _, _, e1 := Syscall6(SYS_WAITID, uintptr(idType), uintptr(id), uintptr(unsafe.Pointer(info)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func KeyctlInt(cmd int, arg2 int, arg3 int, arg4 int, arg5 int) (ret int, err error) { r0, _, e1 := Syscall6(SYS_KEYCTL, uintptr(cmd), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5), 0) ret = int(r0) @@ -818,6 +828,49 @@ func Fsync(fd int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Fsmount(fd int, flags int, mountAttrs int) (fsfd int, err error) { + r0, _, e1 := Syscall(SYS_FSMOUNT, uintptr(fd), uintptr(flags), uintptr(mountAttrs)) + fsfd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fsopen(fsName string, flags int) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fsName) + if err != nil { + return + } + r0, _, e1 := Syscall(SYS_FSOPEN, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fspick(dirfd int, pathName string, flags int) (fd int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(pathName) + if err != nil { + return + } + r0, _, e1 := Syscall(SYS_FSPICK, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Getdents(fd int, buf []byte) (n int, err error) { var _p0 unsafe.Pointer if len(buf) > 0 { @@ -1195,6 +1248,26 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func MoveMount(fromDirfd int, fromPathName string, toDirfd int, toPathName string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fromPathName) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(toPathName) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_MOVE_MOUNT, uintptr(fromDirfd), uintptr(unsafe.Pointer(_p0)), uintptr(toDirfd), uintptr(unsafe.Pointer(_p1)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := Syscall(SYS_NANOSLEEP, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0) if e1 != 0 { @@ -1205,6 +1278,22 @@ func Nanosleep(time *Timespec, leftover *Timespec) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func OpenTree(dfd int, fileName string, flags uint) (r int, err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fileName) + if err != nil { + return + } + r0, _, e1 := Syscall(SYS_OPEN_TREE, uintptr(dfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags)) + r = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_PERF_EVENT_OPEN, uintptr(unsafe.Pointer(attr)), uintptr(pid), uintptr(cpu), uintptr(groupFd), uintptr(flags), 0) fd = int(r0) @@ -1992,6 +2081,16 @@ func PidfdGetfd(pidfd int, targetfd int, flags int) (fd int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func PidfdSendSignal(pidfd int, sig Signal, info *Siginfo, flags int) (err error) { + _, _, e1 := Syscall6(SYS_PIDFD_SEND_SIGNAL, uintptr(pidfd), uintptr(sig), uintptr(unsafe.Pointer(info)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func shmat(id int, addr uintptr, flag int) (ret uintptr, err error) { r0, _, e1 := Syscall(SYS_SHMAT, uintptr(id), uintptr(addr), uintptr(flag)) ret = uintptr(r0) @@ -2032,3 +2131,23 @@ func shmget(key int, size int, flag int) (id int, err error) { } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getitimer(which int, currValue *Itimerval) (err error) { + _, _, e1 := Syscall(SYS_GETITIMER, uintptr(which), uintptr(unsafe.Pointer(currValue)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setitimer(which int, newValue *Itimerval, oldValue *Itimerval) (err error) { + _, _, e1 := Syscall(SYS_SETITIMER, uintptr(which), uintptr(unsafe.Pointer(newValue)), uintptr(unsafe.Pointer(oldValue))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index ff90c81e..88af526b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -l32 -tags linux,386 syscall_linux.go syscall_linux_386.go +// go run mksyscall.go -l32 -tags linux,386 syscall_linux.go syscall_linux_386.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && 386 @@ -200,7 +200,7 @@ func Lstat(path string, stat *Stat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -217,7 +217,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -524,3 +524,14 @@ func utimes(path string, times *[2]Timeval) (err error) { } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index fa7d3dbe..2a0c4aa6 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags linux,amd64 syscall_linux.go syscall_linux_amd64.go +// go run mksyscall.go -tags linux,amd64 syscall_linux.go syscall_linux_amd64.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && amd64 @@ -215,6 +215,17 @@ func Listen(s int, n int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func MemfdSecret(flags int) (fd int, err error) { + r0, _, e1 := Syscall(SYS_MEMFD_SECRET, uintptr(flags), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Pause() (err error) { _, _, e1 := Syscall(SYS_PAUSE, 0, 0, 0) if e1 != 0 { @@ -225,7 +236,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -242,7 +253,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -444,17 +455,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -691,3 +691,14 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index 654f9153..4882bde3 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -46,17 +46,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -549,7 +538,7 @@ func utimes(path string, times *[2]Timeval) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -566,7 +555,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index e893f987..9f8c24e4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -180,7 +180,18 @@ func Listen(s int, n int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func MemfdSecret(flags int) (fd int, err error) { + r0, _, e1 := Syscall(SYS_MEMFD_SECRET, uintptr(flags), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -197,7 +208,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -389,17 +400,6 @@ func Truncate(path string, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go new file mode 100644 index 00000000..523f2ba0 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -0,0 +1,527 @@ +// go run mksyscall.go -tags linux,loong64 syscall_linux.go syscall_linux_loong64.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build linux && loong64 +// +build linux,loong64 + +package unix + +import ( + "syscall" + "unsafe" +) + +var _ syscall.Errno + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fanotifyMark(fd int, flags uint, mask uint64, dirFd int, pathname *byte) (err error) { + _, _, e1 := Syscall6(SYS_FANOTIFY_MARK, uintptr(fd), uintptr(flags), uintptr(mask), uintptr(dirFd), uintptr(unsafe.Pointer(pathname)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fallocate(fd int, mode uint32, off int64, len int64) (err error) { + _, _, e1 := Syscall6(SYS_FALLOCATE, uintptr(fd), uintptr(mode), uintptr(off), uintptr(len), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { + r0, _, e1 := Syscall6(SYS_TEE, uintptr(rfd), uintptr(wfd), uintptr(len), uintptr(flags), 0, 0) + n = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { + var _p0 unsafe.Pointer + if len(events) > 0 { + _p0 = unsafe.Pointer(&events[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_EPOLL_PWAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fadvise(fd int, offset int64, length int64, advice int) (err error) { + _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fchown(fd int, uid int, gid int) (err error) { + _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Fstatfs(fd int, buf *Statfs_t) (err error) { + _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(buf)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Ftruncate(fd int, length int64) (err error) { + _, _, e1 := Syscall(SYS_FTRUNCATE, uintptr(fd), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getegid() (egid int) { + r0, _ := RawSyscallNoError(SYS_GETEGID, 0, 0, 0) + egid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Geteuid() (euid int) { + r0, _ := RawSyscallNoError(SYS_GETEUID, 0, 0, 0) + euid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getgid() (gid int) { + r0, _ := RawSyscallNoError(SYS_GETGID, 0, 0, 0) + gid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Getuid() (uid int) { + r0, _ := RawSyscallNoError(SYS_GETUID, 0, 0, 0) + uid = int(r0) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Listen(s int, n int) (err error) { + _, _, e1 := Syscall(SYS_LISTEN, uintptr(s), uintptr(n), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_PREAD64, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwrite(fd int, p []byte, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_PWRITE64, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Seek(fd int, offset int64, whence int) (off int64, err error) { + r0, _, e1 := Syscall(SYS_LSEEK, uintptr(fd), uintptr(offset), uintptr(whence)) + off = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) { + r0, _, e1 := Syscall6(SYS_SENDFILE, uintptr(outfd), uintptr(infd), uintptr(unsafe.Pointer(offset)), uintptr(count), 0, 0) + written = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setfsgid(gid int) (prev int, err error) { + r0, _, e1 := Syscall(SYS_SETFSGID, uintptr(gid), 0, 0) + prev = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setfsuid(uid int) (prev int, err error) { + r0, _, e1 := Syscall(SYS_SETFSUID, uintptr(uid), 0, 0) + prev = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setregid(rgid int, egid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETREGID, uintptr(rgid), uintptr(egid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresgid(rgid int, egid int, sgid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETRESGID, uintptr(rgid), uintptr(egid), uintptr(sgid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setresuid(ruid int, euid int, suid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETRESUID, uintptr(ruid), uintptr(euid), uintptr(suid)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Setreuid(ruid int, euid int) (err error) { + _, _, e1 := RawSyscall(SYS_SETREUID, uintptr(ruid), uintptr(euid), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Shutdown(fd int, how int) (err error) { + _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) { + r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) + n = int64(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Statfs(path string, buf *Statfs_t) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_STATFS, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func SyncFileRange(fd int, off int64, n int64, flags int) (err error) { + _, _, e1 := Syscall6(SYS_SYNC_FILE_RANGE, uintptr(fd), uintptr(off), uintptr(n), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Truncate(path string, length int64) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall(SYS_TRUNCATE, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { + r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := Syscall(SYS_BIND, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { + _, _, e1 := Syscall(SYS_CONNECT, uintptr(s), uintptr(addr), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getgroups(n int, list *_Gid_t) (nn int, err error) { + r0, _, e1 := RawSyscall(SYS_GETGROUPS, uintptr(n), uintptr(unsafe.Pointer(list)), 0) + nn = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setgroups(n int, list *_Gid_t) (err error) { + _, _, e1 := RawSyscall(SYS_SETGROUPS, uintptr(n), uintptr(unsafe.Pointer(list)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { + _, _, e1 := Syscall6(SYS_GETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { + _, _, e1 := Syscall6(SYS_SETSOCKOPT, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socket(domain int, typ int, proto int) (fd int, err error) { + r0, _, e1 := RawSyscall(SYS_SOCKET, uintptr(domain), uintptr(typ), uintptr(proto)) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { + _, _, e1 := RawSyscall6(SYS_SOCKETPAIR, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := RawSyscall(SYS_GETPEERNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { + _, _, e1 := RawSyscall(SYS_GETSOCKNAME, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) { + var _p0 unsafe.Pointer + if len(p) > 0 { + _p0 = unsafe.Pointer(&p[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_RECVFROM, uintptr(fd), uintptr(_p0), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) { + var _p0 unsafe.Pointer + if len(buf) > 0 { + _p0 = unsafe.Pointer(&buf[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_SENDTO, uintptr(s), uintptr(_p0), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := Syscall(SYS_RECVMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { + r0, _, e1 := Syscall(SYS_SENDMSG, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MMAP, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flags), uintptr(fd), uintptr(offset)) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Gettimeofday(tv *Timeval) (err error) { + _, _, e1 := RawSyscall(SYS_GETTIMEOFDAY, uintptr(unsafe.Pointer(tv)), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(cmdline) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_KEXEC_FILE_LOAD, uintptr(kernelFd), uintptr(initrdFd), uintptr(cmdlineLen), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index 6d155288..d7d6f424 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -b32 -arm -tags linux,mips syscall_linux.go syscall_linux_mipsx.go +// go run mksyscall.go -b32 -arm -tags linux,mips syscall_linux.go syscall_linux_mipsx.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips @@ -150,7 +150,7 @@ func Listen(s int, n int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -167,7 +167,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -344,17 +344,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -702,3 +691,14 @@ func setrlimit(resource int, rlim *rlimit32) (err error) { } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 1e20d72d..7f1f8e65 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags linux,mips64 syscall_linux.go syscall_linux_mips64x.go +// go run mksyscall.go -tags linux,mips64 syscall_linux.go syscall_linux_mips64x.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64 @@ -180,7 +180,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -197,7 +197,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -399,17 +399,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -696,3 +685,14 @@ func stat(path string, st *stat_t) (err error) { } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index 82b5e2d9..f933d0f5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -180,7 +180,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -197,7 +197,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -399,17 +399,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index a0440c1d..297d0a99 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -l32 -arm -tags linux,mipsle syscall_linux.go syscall_linux_mipsx.go +// go run mksyscall.go -l32 -arm -tags linux,mipsle syscall_linux.go syscall_linux_mipsx.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mipsle @@ -150,7 +150,7 @@ func Listen(s int, n int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -167,7 +167,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -344,17 +344,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -702,3 +691,14 @@ func setrlimit(resource int, rlim *rlimit32) (err error) { } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index 5864b9ca..2e32e7a4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -b32 -tags linux,ppc syscall_linux.go syscall_linux_ppc.go +// go run mksyscall.go -b32 -tags linux,ppc syscall_linux.go syscall_linux_ppc.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc @@ -210,7 +210,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -227,7 +227,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -409,17 +409,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -707,3 +696,14 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index beeb49e3..3c531704 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags linux,ppc64 syscall_linux.go syscall_linux_ppc64x.go +// go run mksyscall.go -tags linux,ppc64 syscall_linux.go syscall_linux_ppc64x.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64 @@ -240,7 +240,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -257,7 +257,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -475,17 +475,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -753,3 +742,14 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index 53139b82..a00c6744 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags linux,ppc64le syscall_linux.go syscall_linux_ppc64x.go +// go run mksyscall.go -tags linux,ppc64le syscall_linux.go syscall_linux_ppc64x.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64le @@ -240,7 +240,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -257,7 +257,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -475,17 +475,6 @@ func Ustat(dev int, ubuf *Ustat_t) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -753,3 +742,14 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 63b393b8..1239cc2d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -180,7 +180,18 @@ func Listen(s int, n int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func MemfdSecret(flags int) (fd int, err error) { + r0, _, e1 := Syscall(SYS_MEMFD_SECRET, uintptr(flags), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -197,7 +208,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -369,17 +380,6 @@ func Truncate(path string, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index 202add37..e0dabc60 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags linux,s390x syscall_linux.go syscall_linux_s390x.go +// go run mksyscall.go -tags linux,s390x syscall_linux.go syscall_linux_s390x.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && s390x @@ -210,7 +210,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -227,7 +227,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -533,3 +533,14 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index 2ab268c3..368623c0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -1,4 +1,4 @@ -// go run mksyscall.go -tags linux,sparc64 syscall_linux.go syscall_linux_sparc64.go +// go run mksyscall.go -tags linux,sparc64 syscall_linux.go syscall_linux_sparc64.go syscall_linux_alarm.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && sparc64 @@ -220,7 +220,7 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -237,7 +237,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -455,17 +455,6 @@ func Truncate(path string, length int64) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { - r0, _, e1 := Syscall(SYS_ACCEPT, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen))) - fd = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) @@ -697,3 +686,14 @@ func utimes(path string, times *[2]Timeval) (err error) { } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Alarm(seconds uint) (remaining uint, err error) { + r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) + remaining = uint(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index 51d0c074..4af561a4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -1330,7 +1330,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1347,7 +1347,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index df2efb6d..3b90e944 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -1330,7 +1330,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1347,7 +1347,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index c8536c2c..890f4ccd 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -1330,7 +1330,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1347,7 +1347,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 8b981bfc..c79f071f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -1330,7 +1330,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1347,7 +1347,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 8f80f4ad..a057fc5d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -1128,7 +1128,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1145,7 +1145,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 3a47aca7..04db8fa2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -1128,7 +1128,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1145,7 +1145,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 883a9b45..69f80300 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -1128,7 +1128,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1145,7 +1145,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index aac7fdc9..c96a5051 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -1128,7 +1128,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1145,7 +1145,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 87761874..016d959b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -1128,7 +1128,7 @@ func Pathconf(path string, name int) (val int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) @@ -1145,7 +1145,7 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { _p0 = unsafe.Pointer(&p[0]) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index b5f926ce..fdf53f8d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -66,6 +66,7 @@ import ( //go:cgo_import_dynamic libc_getpriority getpriority "libc.so" //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" //go:cgo_import_dynamic libc_getrusage getrusage "libc.so" +//go:cgo_import_dynamic libc_getsid getsid "libc.so" //go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" //go:cgo_import_dynamic libc_getuid getuid "libc.so" //go:cgo_import_dynamic libc_kill kill "libc.so" @@ -202,6 +203,7 @@ import ( //go:linkname procGetpriority libc_getpriority //go:linkname procGetrlimit libc_getrlimit //go:linkname procGetrusage libc_getrusage +//go:linkname procGetsid libc_getsid //go:linkname procGettimeofday libc_gettimeofday //go:linkname procGetuid libc_getuid //go:linkname procKill libc_kill @@ -227,8 +229,8 @@ import ( //go:linkname procOpenat libc_openat //go:linkname procPathconf libc_pathconf //go:linkname procPause libc_pause -//go:linkname procPread libc_pread -//go:linkname procPwrite libc_pwrite +//go:linkname procpread libc_pread +//go:linkname procpwrite libc_pwrite //go:linkname procread libc_read //go:linkname procReadlink libc_readlink //go:linkname procRename libc_rename @@ -339,6 +341,7 @@ var ( procGetpriority, procGetrlimit, procGetrusage, + procGetsid, procGettimeofday, procGetuid, procKill, @@ -364,8 +367,8 @@ var ( procOpenat, procPathconf, procPause, - procPread, - procPwrite, + procpread, + procpwrite, procread, procReadlink, procRename, @@ -1044,6 +1047,17 @@ func Getrusage(who int, rusage *Rusage) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0) + sid = int(r0) + if e1 != 0 { + err = e1 + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Gettimeofday(tv *Timeval) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0) if e1 != 0 { @@ -1380,12 +1394,12 @@ func Pause() (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pread(fd int, p []byte, offset int64) (n int, err error) { +func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 *byte if len(p) > 0 { _p0 = &p[0] } - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) + r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = e1 @@ -1395,12 +1409,12 @@ func Pread(fd int, p []byte, offset int64) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pwrite(fd int, p []byte, offset int64) (n int, err error) { +func pwrite(fd int, p []byte, offset int64) (n int, err error) { var _p0 *byte if len(p) > 0 { _p0 = &p[0] } - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) + r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { err = e1 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go index 59d5dfc2..4e0d9610 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go @@ -1,4 +1,4 @@ -// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master +// go run mksysnum.go https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12 // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd @@ -19,10 +19,9 @@ const ( SYS_UNLINK = 10 // { int unlink(char *path); } SYS_CHDIR = 12 // { int chdir(char *path); } SYS_FCHDIR = 13 // { int fchdir(int fd); } - SYS_MKNOD = 14 // { int mknod(char *path, int mode, int dev); } SYS_CHMOD = 15 // { int chmod(char *path, int mode); } SYS_CHOWN = 16 // { int chown(char *path, int uid, int gid); } - SYS_OBREAK = 17 // { int obreak(char *nsize); } break obreak_args int + SYS_BREAK = 17 // { caddr_t break(char *nsize); } SYS_GETPID = 20 // { pid_t getpid(void); } SYS_MOUNT = 21 // { int mount(char *type, char *path, int flags, caddr_t data); } SYS_UNMOUNT = 22 // { int unmount(char *path, int flags); } @@ -43,7 +42,6 @@ const ( SYS_KILL = 37 // { int kill(int pid, int signum); } SYS_GETPPID = 39 // { pid_t getppid(void); } SYS_DUP = 41 // { int dup(u_int fd); } - SYS_PIPE = 42 // { int pipe(void); } SYS_GETEGID = 43 // { gid_t getegid(void); } SYS_PROFIL = 44 // { int profil(caddr_t samples, size_t size, size_t offset, u_int scale); } SYS_KTRACE = 45 // { int ktrace(const char *fname, int ops, int facs, int pid); } @@ -58,15 +56,14 @@ const ( SYS_SYMLINK = 57 // { int symlink(char *path, char *link); } SYS_READLINK = 58 // { ssize_t readlink(char *path, char *buf, size_t count); } SYS_EXECVE = 59 // { int execve(char *fname, char **argv, char **envv); } - SYS_UMASK = 60 // { int umask(int newmask); } umask umask_args int + SYS_UMASK = 60 // { int umask(int newmask); } SYS_CHROOT = 61 // { int chroot(char *path); } SYS_MSYNC = 65 // { int msync(void *addr, size_t len, int flags); } SYS_VFORK = 66 // { int vfork(void); } SYS_SBRK = 69 // { int sbrk(int incr); } SYS_SSTK = 70 // { int sstk(int incr); } - SYS_OVADVISE = 72 // { int ovadvise(int anom); } vadvise ovadvise_args int SYS_MUNMAP = 73 // { int munmap(void *addr, size_t len); } - SYS_MPROTECT = 74 // { int mprotect(const void *addr, size_t len, int prot); } + SYS_MPROTECT = 74 // { int mprotect(void *addr, size_t len, int prot); } SYS_MADVISE = 75 // { int madvise(void *addr, size_t len, int behav); } SYS_MINCORE = 78 // { int mincore(const void *addr, size_t len, char *vec); } SYS_GETGROUPS = 79 // { int getgroups(u_int gidsetsize, gid_t *gidset); } @@ -124,14 +121,10 @@ const ( SYS_SETGID = 181 // { int setgid(gid_t gid); } SYS_SETEGID = 182 // { int setegid(gid_t egid); } SYS_SETEUID = 183 // { int seteuid(uid_t euid); } - SYS_STAT = 188 // { int stat(char *path, struct stat *ub); } - SYS_FSTAT = 189 // { int fstat(int fd, struct stat *sb); } - SYS_LSTAT = 190 // { int lstat(char *path, struct stat *ub); } SYS_PATHCONF = 191 // { int pathconf(char *path, int name); } SYS_FPATHCONF = 192 // { int fpathconf(int fd, int name); } SYS_GETRLIMIT = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int SYS_SETRLIMIT = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int - SYS_GETDIRENTRIES = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); } SYS___SYSCTL = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int SYS_MLOCK = 203 // { int mlock(const void *addr, size_t len); } SYS_MUNLOCK = 204 // { int munlock(const void *addr, size_t len); } @@ -143,12 +136,12 @@ const ( SYS_SEMOP = 222 // { int semop(int semid, struct sembuf *sops, size_t nsops); } SYS_MSGGET = 225 // { int msgget(key_t key, int msgflg); } SYS_MSGSND = 226 // { int msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } - SYS_MSGRCV = 227 // { int msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_MSGRCV = 227 // { ssize_t msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } SYS_SHMAT = 228 // { int shmat(int shmid, const void *shmaddr, int shmflg); } SYS_SHMDT = 230 // { int shmdt(const void *shmaddr); } SYS_SHMGET = 231 // { int shmget(key_t key, size_t size, int shmflg); } SYS_CLOCK_GETTIME = 232 // { int clock_gettime(clockid_t clock_id, struct timespec *tp); } - SYS_CLOCK_SETTIME = 233 // { int clock_settime( clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_SETTIME = 233 // { int clock_settime(clockid_t clock_id, const struct timespec *tp); } SYS_CLOCK_GETRES = 234 // { int clock_getres(clockid_t clock_id, struct timespec *tp); } SYS_KTIMER_CREATE = 235 // { int ktimer_create(clockid_t clock_id, struct sigevent *evp, int *timerid); } SYS_KTIMER_DELETE = 236 // { int ktimer_delete(int timerid); } @@ -157,50 +150,44 @@ const ( SYS_KTIMER_GETOVERRUN = 239 // { int ktimer_getoverrun(int timerid); } SYS_NANOSLEEP = 240 // { int nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } SYS_FFCLOCK_GETCOUNTER = 241 // { int ffclock_getcounter(ffcounter *ffcount); } - SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); } - SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); } + SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate(struct ffclock_estimate *cest); } + SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate(struct ffclock_estimate *cest); } SYS_CLOCK_NANOSLEEP = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); } - SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); } + SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id, int which, clockid_t *clock_id); } SYS_NTP_GETTIME = 248 // { int ntp_gettime(struct ntptimeval *ntvp); } SYS_MINHERIT = 250 // { int minherit(void *addr, size_t len, int inherit); } SYS_RFORK = 251 // { int rfork(int flags); } - SYS_OPENBSD_POLL = 252 // { int openbsd_poll(struct pollfd *fds, u_int nfds, int timeout); } SYS_ISSETUGID = 253 // { int issetugid(void); } SYS_LCHOWN = 254 // { int lchown(char *path, int uid, int gid); } SYS_AIO_READ = 255 // { int aio_read(struct aiocb *aiocbp); } SYS_AIO_WRITE = 256 // { int aio_write(struct aiocb *aiocbp); } - SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb * const *acb_list, int nent, struct sigevent *sig); } - SYS_GETDENTS = 272 // { int getdents(int fd, char *buf, size_t count); } + SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb* const *acb_list, int nent, struct sigevent *sig); } SYS_LCHMOD = 274 // { int lchmod(char *path, mode_t mode); } SYS_LUTIMES = 276 // { int lutimes(char *path, struct timeval *tptr); } - SYS_NSTAT = 278 // { int nstat(char *path, struct nstat *ub); } - SYS_NFSTAT = 279 // { int nfstat(int fd, struct nstat *sb); } - SYS_NLSTAT = 280 // { int nlstat(char *path, struct nstat *ub); } SYS_PREADV = 289 // { ssize_t preadv(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_PWRITEV = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_FHOPEN = 298 // { int fhopen(const struct fhandle *u_fhp, int flags); } - SYS_FHSTAT = 299 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } SYS_MODNEXT = 300 // { int modnext(int modid); } - SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat *stat); } + SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat* stat); } SYS_MODFNEXT = 302 // { int modfnext(int modid); } SYS_MODFIND = 303 // { int modfind(const char *name); } SYS_KLDLOAD = 304 // { int kldload(const char *file); } SYS_KLDUNLOAD = 305 // { int kldunload(int fileid); } SYS_KLDFIND = 306 // { int kldfind(const char *file); } SYS_KLDNEXT = 307 // { int kldnext(int fileid); } - SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat* stat); } + SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat *stat); } SYS_KLDFIRSTMOD = 309 // { int kldfirstmod(int fileid); } SYS_GETSID = 310 // { int getsid(pid_t pid); } SYS_SETRESUID = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); } SYS_SETRESGID = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); } SYS_AIO_RETURN = 314 // { ssize_t aio_return(struct aiocb *aiocbp); } - SYS_AIO_SUSPEND = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } + SYS_AIO_SUSPEND = 315 // { int aio_suspend(struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } SYS_AIO_CANCEL = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); } SYS_AIO_ERROR = 317 // { int aio_error(struct aiocb *aiocbp); } SYS_YIELD = 321 // { int yield(void); } SYS_MLOCKALL = 324 // { int mlockall(int how); } SYS_MUNLOCKALL = 325 // { int munlockall(void); } - SYS___GETCWD = 326 // { int __getcwd(char *buf, u_int buflen); } + SYS___GETCWD = 326 // { int __getcwd(char *buf, size_t buflen); } SYS_SCHED_SETPARAM = 327 // { int sched_setparam (pid_t pid, const struct sched_param *param); } SYS_SCHED_GETPARAM = 328 // { int sched_getparam (pid_t pid, struct sched_param *param); } SYS_SCHED_SETSCHEDULER = 329 // { int sched_setscheduler (pid_t pid, int policy, const struct sched_param *param); } @@ -226,14 +213,13 @@ const ( SYS___ACL_ACLCHECK_FILE = 353 // { int __acl_aclcheck_file(const char *path, acl_type_t type, struct acl *aclp); } SYS___ACL_ACLCHECK_FD = 354 // { int __acl_aclcheck_fd(int filedes, acl_type_t type, struct acl *aclp); } SYS_EXTATTRCTL = 355 // { int extattrctl(const char *path, int cmd, const char *filename, int attrnamespace, const char *attrname); } - SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FILE = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); } - SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); } + SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete(struct aiocb **aiocbp, struct timespec *timeout); } SYS_GETRESUID = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } SYS_GETRESGID = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } SYS_KQUEUE = 362 // { int kqueue(void); } - SYS_KEVENT = 363 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } SYS_EXTATTR_SET_FD = 371 // { ssize_t extattr_set_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_GET_FD = 372 // { ssize_t extattr_get_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FD = 373 // { int extattr_delete_fd(int fd, int attrnamespace, const char *attrname); } @@ -251,10 +237,6 @@ const ( SYS_UUIDGEN = 392 // { int uuidgen(struct uuid *store, int count); } SYS_SENDFILE = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); } SYS_MAC_SYSCALL = 394 // { int mac_syscall(const char *policy, int call, void *arg); } - SYS_GETFSSTAT = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } - SYS_STATFS = 396 // { int statfs(char *path, struct statfs *buf); } - SYS_FSTATFS = 397 // { int fstatfs(int fd, struct statfs *buf); } - SYS_FHSTATFS = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } SYS_KSEM_CLOSE = 400 // { int ksem_close(semid_t id); } SYS_KSEM_POST = 401 // { int ksem_post(semid_t id); } SYS_KSEM_WAIT = 402 // { int ksem_wait(semid_t id); } @@ -267,14 +249,14 @@ const ( SYS___MAC_GET_PID = 409 // { int __mac_get_pid(pid_t pid, struct mac *mac_p); } SYS___MAC_GET_LINK = 410 // { int __mac_get_link(const char *path_p, struct mac *mac_p); } SYS___MAC_SET_LINK = 411 // { int __mac_set_link(const char *path_p, struct mac *mac_p); } - SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link( const char *path, int attrnamespace, const char *attrname); } + SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link(const char *path, int attrnamespace, const char *attrname); } SYS___MAC_EXECVE = 415 // { int __mac_execve(char *fname, char **argv, char **envv, struct mac *mac_p); } SYS_SIGACTION = 416 // { int sigaction(int sig, const struct sigaction *act, struct sigaction *oact); } - SYS_SIGRETURN = 417 // { int sigreturn( const struct __ucontext *sigcntxp); } + SYS_SIGRETURN = 417 // { int sigreturn(const struct __ucontext *sigcntxp); } SYS_GETCONTEXT = 421 // { int getcontext(struct __ucontext *ucp); } - SYS_SETCONTEXT = 422 // { int setcontext( const struct __ucontext *ucp); } + SYS_SETCONTEXT = 422 // { int setcontext(const struct __ucontext *ucp); } SYS_SWAPCONTEXT = 423 // { int swapcontext(struct __ucontext *oucp, const struct __ucontext *ucp); } SYS_SWAPOFF = 424 // { int swapoff(const char *name); } SYS___ACL_GET_LINK = 425 // { int __acl_get_link(const char *path, acl_type_t type, struct acl *aclp); } @@ -288,10 +270,10 @@ const ( SYS_THR_KILL = 433 // { int thr_kill(long id, int sig); } SYS_JAIL_ATTACH = 436 // { int jail_attach(int jid); } SYS_EXTATTR_LIST_FD = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link( const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file(const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link(const char *path, int attrnamespace, void *data, size_t nbytes); } SYS_KSEM_TIMEDWAIT = 441 // { int ksem_timedwait(semid_t id, const struct timespec *abstime); } - SYS_THR_SUSPEND = 442 // { int thr_suspend( const struct timespec *timeout); } + SYS_THR_SUSPEND = 442 // { int thr_suspend(const struct timespec *timeout); } SYS_THR_WAKE = 443 // { int thr_wake(long id); } SYS_KLDUNLOADF = 444 // { int kldunloadf(int fileid, int flags); } SYS_AUDIT = 445 // { int audit(const void *record, u_int length); } @@ -300,17 +282,17 @@ const ( SYS_SETAUID = 448 // { int setauid(uid_t *auid); } SYS_GETAUDIT = 449 // { int getaudit(struct auditinfo *auditinfo); } SYS_SETAUDIT = 450 // { int setaudit(struct auditinfo *auditinfo); } - SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } - SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } SYS_AUDITCTL = 453 // { int auditctl(char *path); } SYS__UMTX_OP = 454 // { int _umtx_op(void *obj, int op, u_long val, void *uaddr1, void *uaddr2); } SYS_THR_NEW = 455 // { int thr_new(struct thr_param *param, int param_size); } SYS_SIGQUEUE = 456 // { int sigqueue(pid_t pid, int signum, void *value); } SYS_KMQ_OPEN = 457 // { int kmq_open(const char *path, int flags, mode_t mode, const struct mq_attr *attr); } - SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } - SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } - SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len,unsigned msg_prio, const struct timespec *abs_timeout);} - SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } + SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } + SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len, unsigned msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } SYS_KMQ_UNLINK = 462 // { int kmq_unlink(const char *path); } SYS_ABORT2 = 463 // { int abort2(const char *why, int nargs, void **args); } SYS_THR_SET_NAME = 464 // { int thr_set_name(long id, const char *name); } @@ -319,7 +301,7 @@ const ( SYS_SCTP_PEELOFF = 471 // { int sctp_peeloff(int sd, uint32_t name); } SYS_SCTP_GENERIC_SENDMSG = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } - SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr * from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } + SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr *from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } SYS_PREAD = 475 // { ssize_t pread(int fd, void *buf, size_t nbyte, off_t offset); } SYS_PWRITE = 476 // { ssize_t pwrite(int fd, const void *buf, size_t nbyte, off_t offset); } SYS_MMAP = 477 // { caddr_t mmap(caddr_t addr, size_t len, int prot, int flags, int fd, off_t pos); } @@ -338,14 +320,12 @@ const ( SYS_FCHMODAT = 490 // { int fchmodat(int fd, char *path, mode_t mode, int flag); } SYS_FCHOWNAT = 491 // { int fchownat(int fd, char *path, uid_t uid, gid_t gid, int flag); } SYS_FEXECVE = 492 // { int fexecve(int fd, char **argv, char **envv); } - SYS_FSTATAT = 493 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } SYS_FUTIMESAT = 494 // { int futimesat(int fd, char *path, struct timeval *times); } SYS_LINKAT = 495 // { int linkat(int fd1, char *path1, int fd2, char *path2, int flag); } SYS_MKDIRAT = 496 // { int mkdirat(int fd, char *path, mode_t mode); } SYS_MKFIFOAT = 497 // { int mkfifoat(int fd, char *path, mode_t mode); } - SYS_MKNODAT = 498 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } SYS_OPENAT = 499 // { int openat(int fd, char *path, int flag, mode_t mode); } - SYS_READLINKAT = 500 // { int readlinkat(int fd, char *path, char *buf, size_t bufsize); } + SYS_READLINKAT = 500 // { ssize_t readlinkat(int fd, char *path, char *buf, size_t bufsize); } SYS_RENAMEAT = 501 // { int renameat(int oldfd, char *old, int newfd, char *new); } SYS_SYMLINKAT = 502 // { int symlinkat(char *path1, int fd, char *path2); } SYS_UNLINKAT = 503 // { int unlinkat(int fd, char *path, int flag); } @@ -391,7 +371,24 @@ const ( SYS_PPOLL = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); } SYS_FUTIMENS = 546 // { int futimens(int fd, struct timespec *times); } SYS_UTIMENSAT = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); } - SYS_NUMA_GETAFFINITY = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); } - SYS_NUMA_SETAFFINITY = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); } SYS_FDATASYNC = 550 // { int fdatasync(int fd); } + SYS_FSTAT = 551 // { int fstat(int fd, struct stat *sb); } + SYS_FSTATAT = 552 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } + SYS_FHSTAT = 553 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } + SYS_GETDIRENTRIES = 554 // { ssize_t getdirentries(int fd, char *buf, size_t count, off_t *basep); } + SYS_STATFS = 555 // { int statfs(char *path, struct statfs *buf); } + SYS_FSTATFS = 556 // { int fstatfs(int fd, struct statfs *buf); } + SYS_GETFSSTAT = 557 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } + SYS_FHSTATFS = 558 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } + SYS_MKNODAT = 559 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } + SYS_KEVENT = 560 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_CPUSET_GETDOMAIN = 561 // { int cpuset_getdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int *policy); } + SYS_CPUSET_SETDOMAIN = 562 // { int cpuset_setdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int policy); } + SYS_GETRANDOM = 563 // { int getrandom(void *buf, size_t buflen, unsigned int flags); } + SYS_GETFHAT = 564 // { int getfhat(int fd, char *path, struct fhandle *fhp, int flags); } + SYS_FHLINK = 565 // { int fhlink(struct fhandle *fhp, const char *to); } + SYS_FHLINKAT = 566 // { int fhlinkat(struct fhandle *fhp, int tofd, const char *to,); } + SYS_FHREADLINK = 567 // { int fhreadlink(struct fhandle *fhp, char *buf, size_t bufsize); } + SYS___SYSCTLBYNAME = 570 // { int __sysctlbyname(const char *name, size_t namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_CLOSE_RANGE = 575 // { int close_range(u_int lowfd, u_int highfd, int flags); } ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go index 342d471d..01636b83 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go @@ -1,4 +1,4 @@ -// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master +// go run mksysnum.go https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12 // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd @@ -19,10 +19,9 @@ const ( SYS_UNLINK = 10 // { int unlink(char *path); } SYS_CHDIR = 12 // { int chdir(char *path); } SYS_FCHDIR = 13 // { int fchdir(int fd); } - SYS_MKNOD = 14 // { int mknod(char *path, int mode, int dev); } SYS_CHMOD = 15 // { int chmod(char *path, int mode); } SYS_CHOWN = 16 // { int chown(char *path, int uid, int gid); } - SYS_OBREAK = 17 // { int obreak(char *nsize); } break obreak_args int + SYS_BREAK = 17 // { caddr_t break(char *nsize); } SYS_GETPID = 20 // { pid_t getpid(void); } SYS_MOUNT = 21 // { int mount(char *type, char *path, int flags, caddr_t data); } SYS_UNMOUNT = 22 // { int unmount(char *path, int flags); } @@ -43,7 +42,6 @@ const ( SYS_KILL = 37 // { int kill(int pid, int signum); } SYS_GETPPID = 39 // { pid_t getppid(void); } SYS_DUP = 41 // { int dup(u_int fd); } - SYS_PIPE = 42 // { int pipe(void); } SYS_GETEGID = 43 // { gid_t getegid(void); } SYS_PROFIL = 44 // { int profil(caddr_t samples, size_t size, size_t offset, u_int scale); } SYS_KTRACE = 45 // { int ktrace(const char *fname, int ops, int facs, int pid); } @@ -58,15 +56,14 @@ const ( SYS_SYMLINK = 57 // { int symlink(char *path, char *link); } SYS_READLINK = 58 // { ssize_t readlink(char *path, char *buf, size_t count); } SYS_EXECVE = 59 // { int execve(char *fname, char **argv, char **envv); } - SYS_UMASK = 60 // { int umask(int newmask); } umask umask_args int + SYS_UMASK = 60 // { int umask(int newmask); } SYS_CHROOT = 61 // { int chroot(char *path); } SYS_MSYNC = 65 // { int msync(void *addr, size_t len, int flags); } SYS_VFORK = 66 // { int vfork(void); } SYS_SBRK = 69 // { int sbrk(int incr); } SYS_SSTK = 70 // { int sstk(int incr); } - SYS_OVADVISE = 72 // { int ovadvise(int anom); } vadvise ovadvise_args int SYS_MUNMAP = 73 // { int munmap(void *addr, size_t len); } - SYS_MPROTECT = 74 // { int mprotect(const void *addr, size_t len, int prot); } + SYS_MPROTECT = 74 // { int mprotect(void *addr, size_t len, int prot); } SYS_MADVISE = 75 // { int madvise(void *addr, size_t len, int behav); } SYS_MINCORE = 78 // { int mincore(const void *addr, size_t len, char *vec); } SYS_GETGROUPS = 79 // { int getgroups(u_int gidsetsize, gid_t *gidset); } @@ -124,14 +121,10 @@ const ( SYS_SETGID = 181 // { int setgid(gid_t gid); } SYS_SETEGID = 182 // { int setegid(gid_t egid); } SYS_SETEUID = 183 // { int seteuid(uid_t euid); } - SYS_STAT = 188 // { int stat(char *path, struct stat *ub); } - SYS_FSTAT = 189 // { int fstat(int fd, struct stat *sb); } - SYS_LSTAT = 190 // { int lstat(char *path, struct stat *ub); } SYS_PATHCONF = 191 // { int pathconf(char *path, int name); } SYS_FPATHCONF = 192 // { int fpathconf(int fd, int name); } SYS_GETRLIMIT = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int SYS_SETRLIMIT = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int - SYS_GETDIRENTRIES = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); } SYS___SYSCTL = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int SYS_MLOCK = 203 // { int mlock(const void *addr, size_t len); } SYS_MUNLOCK = 204 // { int munlock(const void *addr, size_t len); } @@ -143,12 +136,12 @@ const ( SYS_SEMOP = 222 // { int semop(int semid, struct sembuf *sops, size_t nsops); } SYS_MSGGET = 225 // { int msgget(key_t key, int msgflg); } SYS_MSGSND = 226 // { int msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } - SYS_MSGRCV = 227 // { int msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_MSGRCV = 227 // { ssize_t msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } SYS_SHMAT = 228 // { int shmat(int shmid, const void *shmaddr, int shmflg); } SYS_SHMDT = 230 // { int shmdt(const void *shmaddr); } SYS_SHMGET = 231 // { int shmget(key_t key, size_t size, int shmflg); } SYS_CLOCK_GETTIME = 232 // { int clock_gettime(clockid_t clock_id, struct timespec *tp); } - SYS_CLOCK_SETTIME = 233 // { int clock_settime( clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_SETTIME = 233 // { int clock_settime(clockid_t clock_id, const struct timespec *tp); } SYS_CLOCK_GETRES = 234 // { int clock_getres(clockid_t clock_id, struct timespec *tp); } SYS_KTIMER_CREATE = 235 // { int ktimer_create(clockid_t clock_id, struct sigevent *evp, int *timerid); } SYS_KTIMER_DELETE = 236 // { int ktimer_delete(int timerid); } @@ -157,50 +150,44 @@ const ( SYS_KTIMER_GETOVERRUN = 239 // { int ktimer_getoverrun(int timerid); } SYS_NANOSLEEP = 240 // { int nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } SYS_FFCLOCK_GETCOUNTER = 241 // { int ffclock_getcounter(ffcounter *ffcount); } - SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); } - SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); } + SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate(struct ffclock_estimate *cest); } + SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate(struct ffclock_estimate *cest); } SYS_CLOCK_NANOSLEEP = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); } - SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); } + SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id, int which, clockid_t *clock_id); } SYS_NTP_GETTIME = 248 // { int ntp_gettime(struct ntptimeval *ntvp); } SYS_MINHERIT = 250 // { int minherit(void *addr, size_t len, int inherit); } SYS_RFORK = 251 // { int rfork(int flags); } - SYS_OPENBSD_POLL = 252 // { int openbsd_poll(struct pollfd *fds, u_int nfds, int timeout); } SYS_ISSETUGID = 253 // { int issetugid(void); } SYS_LCHOWN = 254 // { int lchown(char *path, int uid, int gid); } SYS_AIO_READ = 255 // { int aio_read(struct aiocb *aiocbp); } SYS_AIO_WRITE = 256 // { int aio_write(struct aiocb *aiocbp); } - SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb * const *acb_list, int nent, struct sigevent *sig); } - SYS_GETDENTS = 272 // { int getdents(int fd, char *buf, size_t count); } + SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb* const *acb_list, int nent, struct sigevent *sig); } SYS_LCHMOD = 274 // { int lchmod(char *path, mode_t mode); } SYS_LUTIMES = 276 // { int lutimes(char *path, struct timeval *tptr); } - SYS_NSTAT = 278 // { int nstat(char *path, struct nstat *ub); } - SYS_NFSTAT = 279 // { int nfstat(int fd, struct nstat *sb); } - SYS_NLSTAT = 280 // { int nlstat(char *path, struct nstat *ub); } SYS_PREADV = 289 // { ssize_t preadv(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_PWRITEV = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_FHOPEN = 298 // { int fhopen(const struct fhandle *u_fhp, int flags); } - SYS_FHSTAT = 299 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } SYS_MODNEXT = 300 // { int modnext(int modid); } - SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat *stat); } + SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat* stat); } SYS_MODFNEXT = 302 // { int modfnext(int modid); } SYS_MODFIND = 303 // { int modfind(const char *name); } SYS_KLDLOAD = 304 // { int kldload(const char *file); } SYS_KLDUNLOAD = 305 // { int kldunload(int fileid); } SYS_KLDFIND = 306 // { int kldfind(const char *file); } SYS_KLDNEXT = 307 // { int kldnext(int fileid); } - SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat* stat); } + SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat *stat); } SYS_KLDFIRSTMOD = 309 // { int kldfirstmod(int fileid); } SYS_GETSID = 310 // { int getsid(pid_t pid); } SYS_SETRESUID = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); } SYS_SETRESGID = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); } SYS_AIO_RETURN = 314 // { ssize_t aio_return(struct aiocb *aiocbp); } - SYS_AIO_SUSPEND = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } + SYS_AIO_SUSPEND = 315 // { int aio_suspend(struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } SYS_AIO_CANCEL = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); } SYS_AIO_ERROR = 317 // { int aio_error(struct aiocb *aiocbp); } SYS_YIELD = 321 // { int yield(void); } SYS_MLOCKALL = 324 // { int mlockall(int how); } SYS_MUNLOCKALL = 325 // { int munlockall(void); } - SYS___GETCWD = 326 // { int __getcwd(char *buf, u_int buflen); } + SYS___GETCWD = 326 // { int __getcwd(char *buf, size_t buflen); } SYS_SCHED_SETPARAM = 327 // { int sched_setparam (pid_t pid, const struct sched_param *param); } SYS_SCHED_GETPARAM = 328 // { int sched_getparam (pid_t pid, struct sched_param *param); } SYS_SCHED_SETSCHEDULER = 329 // { int sched_setscheduler (pid_t pid, int policy, const struct sched_param *param); } @@ -226,14 +213,13 @@ const ( SYS___ACL_ACLCHECK_FILE = 353 // { int __acl_aclcheck_file(const char *path, acl_type_t type, struct acl *aclp); } SYS___ACL_ACLCHECK_FD = 354 // { int __acl_aclcheck_fd(int filedes, acl_type_t type, struct acl *aclp); } SYS_EXTATTRCTL = 355 // { int extattrctl(const char *path, int cmd, const char *filename, int attrnamespace, const char *attrname); } - SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FILE = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); } - SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); } + SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete(struct aiocb **aiocbp, struct timespec *timeout); } SYS_GETRESUID = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } SYS_GETRESGID = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } SYS_KQUEUE = 362 // { int kqueue(void); } - SYS_KEVENT = 363 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } SYS_EXTATTR_SET_FD = 371 // { ssize_t extattr_set_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_GET_FD = 372 // { ssize_t extattr_get_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FD = 373 // { int extattr_delete_fd(int fd, int attrnamespace, const char *attrname); } @@ -251,10 +237,6 @@ const ( SYS_UUIDGEN = 392 // { int uuidgen(struct uuid *store, int count); } SYS_SENDFILE = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); } SYS_MAC_SYSCALL = 394 // { int mac_syscall(const char *policy, int call, void *arg); } - SYS_GETFSSTAT = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } - SYS_STATFS = 396 // { int statfs(char *path, struct statfs *buf); } - SYS_FSTATFS = 397 // { int fstatfs(int fd, struct statfs *buf); } - SYS_FHSTATFS = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } SYS_KSEM_CLOSE = 400 // { int ksem_close(semid_t id); } SYS_KSEM_POST = 401 // { int ksem_post(semid_t id); } SYS_KSEM_WAIT = 402 // { int ksem_wait(semid_t id); } @@ -267,14 +249,14 @@ const ( SYS___MAC_GET_PID = 409 // { int __mac_get_pid(pid_t pid, struct mac *mac_p); } SYS___MAC_GET_LINK = 410 // { int __mac_get_link(const char *path_p, struct mac *mac_p); } SYS___MAC_SET_LINK = 411 // { int __mac_set_link(const char *path_p, struct mac *mac_p); } - SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link( const char *path, int attrnamespace, const char *attrname); } + SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link(const char *path, int attrnamespace, const char *attrname); } SYS___MAC_EXECVE = 415 // { int __mac_execve(char *fname, char **argv, char **envv, struct mac *mac_p); } SYS_SIGACTION = 416 // { int sigaction(int sig, const struct sigaction *act, struct sigaction *oact); } - SYS_SIGRETURN = 417 // { int sigreturn( const struct __ucontext *sigcntxp); } + SYS_SIGRETURN = 417 // { int sigreturn(const struct __ucontext *sigcntxp); } SYS_GETCONTEXT = 421 // { int getcontext(struct __ucontext *ucp); } - SYS_SETCONTEXT = 422 // { int setcontext( const struct __ucontext *ucp); } + SYS_SETCONTEXT = 422 // { int setcontext(const struct __ucontext *ucp); } SYS_SWAPCONTEXT = 423 // { int swapcontext(struct __ucontext *oucp, const struct __ucontext *ucp); } SYS_SWAPOFF = 424 // { int swapoff(const char *name); } SYS___ACL_GET_LINK = 425 // { int __acl_get_link(const char *path, acl_type_t type, struct acl *aclp); } @@ -288,10 +270,10 @@ const ( SYS_THR_KILL = 433 // { int thr_kill(long id, int sig); } SYS_JAIL_ATTACH = 436 // { int jail_attach(int jid); } SYS_EXTATTR_LIST_FD = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link( const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file(const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link(const char *path, int attrnamespace, void *data, size_t nbytes); } SYS_KSEM_TIMEDWAIT = 441 // { int ksem_timedwait(semid_t id, const struct timespec *abstime); } - SYS_THR_SUSPEND = 442 // { int thr_suspend( const struct timespec *timeout); } + SYS_THR_SUSPEND = 442 // { int thr_suspend(const struct timespec *timeout); } SYS_THR_WAKE = 443 // { int thr_wake(long id); } SYS_KLDUNLOADF = 444 // { int kldunloadf(int fileid, int flags); } SYS_AUDIT = 445 // { int audit(const void *record, u_int length); } @@ -300,17 +282,17 @@ const ( SYS_SETAUID = 448 // { int setauid(uid_t *auid); } SYS_GETAUDIT = 449 // { int getaudit(struct auditinfo *auditinfo); } SYS_SETAUDIT = 450 // { int setaudit(struct auditinfo *auditinfo); } - SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } - SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } SYS_AUDITCTL = 453 // { int auditctl(char *path); } SYS__UMTX_OP = 454 // { int _umtx_op(void *obj, int op, u_long val, void *uaddr1, void *uaddr2); } SYS_THR_NEW = 455 // { int thr_new(struct thr_param *param, int param_size); } SYS_SIGQUEUE = 456 // { int sigqueue(pid_t pid, int signum, void *value); } SYS_KMQ_OPEN = 457 // { int kmq_open(const char *path, int flags, mode_t mode, const struct mq_attr *attr); } - SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } - SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } - SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len,unsigned msg_prio, const struct timespec *abs_timeout);} - SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } + SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } + SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len, unsigned msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } SYS_KMQ_UNLINK = 462 // { int kmq_unlink(const char *path); } SYS_ABORT2 = 463 // { int abort2(const char *why, int nargs, void **args); } SYS_THR_SET_NAME = 464 // { int thr_set_name(long id, const char *name); } @@ -319,7 +301,7 @@ const ( SYS_SCTP_PEELOFF = 471 // { int sctp_peeloff(int sd, uint32_t name); } SYS_SCTP_GENERIC_SENDMSG = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } - SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr * from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } + SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr *from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } SYS_PREAD = 475 // { ssize_t pread(int fd, void *buf, size_t nbyte, off_t offset); } SYS_PWRITE = 476 // { ssize_t pwrite(int fd, const void *buf, size_t nbyte, off_t offset); } SYS_MMAP = 477 // { caddr_t mmap(caddr_t addr, size_t len, int prot, int flags, int fd, off_t pos); } @@ -338,14 +320,12 @@ const ( SYS_FCHMODAT = 490 // { int fchmodat(int fd, char *path, mode_t mode, int flag); } SYS_FCHOWNAT = 491 // { int fchownat(int fd, char *path, uid_t uid, gid_t gid, int flag); } SYS_FEXECVE = 492 // { int fexecve(int fd, char **argv, char **envv); } - SYS_FSTATAT = 493 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } SYS_FUTIMESAT = 494 // { int futimesat(int fd, char *path, struct timeval *times); } SYS_LINKAT = 495 // { int linkat(int fd1, char *path1, int fd2, char *path2, int flag); } SYS_MKDIRAT = 496 // { int mkdirat(int fd, char *path, mode_t mode); } SYS_MKFIFOAT = 497 // { int mkfifoat(int fd, char *path, mode_t mode); } - SYS_MKNODAT = 498 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } SYS_OPENAT = 499 // { int openat(int fd, char *path, int flag, mode_t mode); } - SYS_READLINKAT = 500 // { int readlinkat(int fd, char *path, char *buf, size_t bufsize); } + SYS_READLINKAT = 500 // { ssize_t readlinkat(int fd, char *path, char *buf, size_t bufsize); } SYS_RENAMEAT = 501 // { int renameat(int oldfd, char *old, int newfd, char *new); } SYS_SYMLINKAT = 502 // { int symlinkat(char *path1, int fd, char *path2); } SYS_UNLINKAT = 503 // { int unlinkat(int fd, char *path, int flag); } @@ -391,7 +371,24 @@ const ( SYS_PPOLL = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); } SYS_FUTIMENS = 546 // { int futimens(int fd, struct timespec *times); } SYS_UTIMENSAT = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); } - SYS_NUMA_GETAFFINITY = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); } - SYS_NUMA_SETAFFINITY = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); } SYS_FDATASYNC = 550 // { int fdatasync(int fd); } + SYS_FSTAT = 551 // { int fstat(int fd, struct stat *sb); } + SYS_FSTATAT = 552 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } + SYS_FHSTAT = 553 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } + SYS_GETDIRENTRIES = 554 // { ssize_t getdirentries(int fd, char *buf, size_t count, off_t *basep); } + SYS_STATFS = 555 // { int statfs(char *path, struct statfs *buf); } + SYS_FSTATFS = 556 // { int fstatfs(int fd, struct statfs *buf); } + SYS_GETFSSTAT = 557 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } + SYS_FHSTATFS = 558 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } + SYS_MKNODAT = 559 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } + SYS_KEVENT = 560 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_CPUSET_GETDOMAIN = 561 // { int cpuset_getdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int *policy); } + SYS_CPUSET_SETDOMAIN = 562 // { int cpuset_setdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int policy); } + SYS_GETRANDOM = 563 // { int getrandom(void *buf, size_t buflen, unsigned int flags); } + SYS_GETFHAT = 564 // { int getfhat(int fd, char *path, struct fhandle *fhp, int flags); } + SYS_FHLINK = 565 // { int fhlink(struct fhandle *fhp, const char *to); } + SYS_FHLINKAT = 566 // { int fhlinkat(struct fhandle *fhp, int tofd, const char *to,); } + SYS_FHREADLINK = 567 // { int fhreadlink(struct fhandle *fhp, char *buf, size_t bufsize); } + SYS___SYSCTLBYNAME = 570 // { int __sysctlbyname(const char *name, size_t namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_CLOSE_RANGE = 575 // { int close_range(u_int lowfd, u_int highfd, int flags); } ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go index e2e3d72c..ad99bc10 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go @@ -1,4 +1,4 @@ -// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master +// go run mksysnum.go https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12 // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd @@ -19,10 +19,9 @@ const ( SYS_UNLINK = 10 // { int unlink(char *path); } SYS_CHDIR = 12 // { int chdir(char *path); } SYS_FCHDIR = 13 // { int fchdir(int fd); } - SYS_MKNOD = 14 // { int mknod(char *path, int mode, int dev); } SYS_CHMOD = 15 // { int chmod(char *path, int mode); } SYS_CHOWN = 16 // { int chown(char *path, int uid, int gid); } - SYS_OBREAK = 17 // { int obreak(char *nsize); } break obreak_args int + SYS_BREAK = 17 // { caddr_t break(char *nsize); } SYS_GETPID = 20 // { pid_t getpid(void); } SYS_MOUNT = 21 // { int mount(char *type, char *path, int flags, caddr_t data); } SYS_UNMOUNT = 22 // { int unmount(char *path, int flags); } @@ -43,7 +42,6 @@ const ( SYS_KILL = 37 // { int kill(int pid, int signum); } SYS_GETPPID = 39 // { pid_t getppid(void); } SYS_DUP = 41 // { int dup(u_int fd); } - SYS_PIPE = 42 // { int pipe(void); } SYS_GETEGID = 43 // { gid_t getegid(void); } SYS_PROFIL = 44 // { int profil(caddr_t samples, size_t size, size_t offset, u_int scale); } SYS_KTRACE = 45 // { int ktrace(const char *fname, int ops, int facs, int pid); } @@ -58,15 +56,14 @@ const ( SYS_SYMLINK = 57 // { int symlink(char *path, char *link); } SYS_READLINK = 58 // { ssize_t readlink(char *path, char *buf, size_t count); } SYS_EXECVE = 59 // { int execve(char *fname, char **argv, char **envv); } - SYS_UMASK = 60 // { int umask(int newmask); } umask umask_args int + SYS_UMASK = 60 // { int umask(int newmask); } SYS_CHROOT = 61 // { int chroot(char *path); } SYS_MSYNC = 65 // { int msync(void *addr, size_t len, int flags); } SYS_VFORK = 66 // { int vfork(void); } SYS_SBRK = 69 // { int sbrk(int incr); } SYS_SSTK = 70 // { int sstk(int incr); } - SYS_OVADVISE = 72 // { int ovadvise(int anom); } vadvise ovadvise_args int SYS_MUNMAP = 73 // { int munmap(void *addr, size_t len); } - SYS_MPROTECT = 74 // { int mprotect(const void *addr, size_t len, int prot); } + SYS_MPROTECT = 74 // { int mprotect(void *addr, size_t len, int prot); } SYS_MADVISE = 75 // { int madvise(void *addr, size_t len, int behav); } SYS_MINCORE = 78 // { int mincore(const void *addr, size_t len, char *vec); } SYS_GETGROUPS = 79 // { int getgroups(u_int gidsetsize, gid_t *gidset); } @@ -124,14 +121,10 @@ const ( SYS_SETGID = 181 // { int setgid(gid_t gid); } SYS_SETEGID = 182 // { int setegid(gid_t egid); } SYS_SETEUID = 183 // { int seteuid(uid_t euid); } - SYS_STAT = 188 // { int stat(char *path, struct stat *ub); } - SYS_FSTAT = 189 // { int fstat(int fd, struct stat *sb); } - SYS_LSTAT = 190 // { int lstat(char *path, struct stat *ub); } SYS_PATHCONF = 191 // { int pathconf(char *path, int name); } SYS_FPATHCONF = 192 // { int fpathconf(int fd, int name); } SYS_GETRLIMIT = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int SYS_SETRLIMIT = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int - SYS_GETDIRENTRIES = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); } SYS___SYSCTL = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int SYS_MLOCK = 203 // { int mlock(const void *addr, size_t len); } SYS_MUNLOCK = 204 // { int munlock(const void *addr, size_t len); } @@ -143,12 +136,12 @@ const ( SYS_SEMOP = 222 // { int semop(int semid, struct sembuf *sops, size_t nsops); } SYS_MSGGET = 225 // { int msgget(key_t key, int msgflg); } SYS_MSGSND = 226 // { int msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } - SYS_MSGRCV = 227 // { int msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_MSGRCV = 227 // { ssize_t msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } SYS_SHMAT = 228 // { int shmat(int shmid, const void *shmaddr, int shmflg); } SYS_SHMDT = 230 // { int shmdt(const void *shmaddr); } SYS_SHMGET = 231 // { int shmget(key_t key, size_t size, int shmflg); } SYS_CLOCK_GETTIME = 232 // { int clock_gettime(clockid_t clock_id, struct timespec *tp); } - SYS_CLOCK_SETTIME = 233 // { int clock_settime( clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_SETTIME = 233 // { int clock_settime(clockid_t clock_id, const struct timespec *tp); } SYS_CLOCK_GETRES = 234 // { int clock_getres(clockid_t clock_id, struct timespec *tp); } SYS_KTIMER_CREATE = 235 // { int ktimer_create(clockid_t clock_id, struct sigevent *evp, int *timerid); } SYS_KTIMER_DELETE = 236 // { int ktimer_delete(int timerid); } @@ -157,50 +150,44 @@ const ( SYS_KTIMER_GETOVERRUN = 239 // { int ktimer_getoverrun(int timerid); } SYS_NANOSLEEP = 240 // { int nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } SYS_FFCLOCK_GETCOUNTER = 241 // { int ffclock_getcounter(ffcounter *ffcount); } - SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); } - SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); } + SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate(struct ffclock_estimate *cest); } + SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate(struct ffclock_estimate *cest); } SYS_CLOCK_NANOSLEEP = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); } - SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); } + SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id, int which, clockid_t *clock_id); } SYS_NTP_GETTIME = 248 // { int ntp_gettime(struct ntptimeval *ntvp); } SYS_MINHERIT = 250 // { int minherit(void *addr, size_t len, int inherit); } SYS_RFORK = 251 // { int rfork(int flags); } - SYS_OPENBSD_POLL = 252 // { int openbsd_poll(struct pollfd *fds, u_int nfds, int timeout); } SYS_ISSETUGID = 253 // { int issetugid(void); } SYS_LCHOWN = 254 // { int lchown(char *path, int uid, int gid); } SYS_AIO_READ = 255 // { int aio_read(struct aiocb *aiocbp); } SYS_AIO_WRITE = 256 // { int aio_write(struct aiocb *aiocbp); } - SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb * const *acb_list, int nent, struct sigevent *sig); } - SYS_GETDENTS = 272 // { int getdents(int fd, char *buf, size_t count); } + SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb* const *acb_list, int nent, struct sigevent *sig); } SYS_LCHMOD = 274 // { int lchmod(char *path, mode_t mode); } SYS_LUTIMES = 276 // { int lutimes(char *path, struct timeval *tptr); } - SYS_NSTAT = 278 // { int nstat(char *path, struct nstat *ub); } - SYS_NFSTAT = 279 // { int nfstat(int fd, struct nstat *sb); } - SYS_NLSTAT = 280 // { int nlstat(char *path, struct nstat *ub); } SYS_PREADV = 289 // { ssize_t preadv(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_PWRITEV = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_FHOPEN = 298 // { int fhopen(const struct fhandle *u_fhp, int flags); } - SYS_FHSTAT = 299 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } SYS_MODNEXT = 300 // { int modnext(int modid); } - SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat *stat); } + SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat* stat); } SYS_MODFNEXT = 302 // { int modfnext(int modid); } SYS_MODFIND = 303 // { int modfind(const char *name); } SYS_KLDLOAD = 304 // { int kldload(const char *file); } SYS_KLDUNLOAD = 305 // { int kldunload(int fileid); } SYS_KLDFIND = 306 // { int kldfind(const char *file); } SYS_KLDNEXT = 307 // { int kldnext(int fileid); } - SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat* stat); } + SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat *stat); } SYS_KLDFIRSTMOD = 309 // { int kldfirstmod(int fileid); } SYS_GETSID = 310 // { int getsid(pid_t pid); } SYS_SETRESUID = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); } SYS_SETRESGID = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); } SYS_AIO_RETURN = 314 // { ssize_t aio_return(struct aiocb *aiocbp); } - SYS_AIO_SUSPEND = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } + SYS_AIO_SUSPEND = 315 // { int aio_suspend(struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } SYS_AIO_CANCEL = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); } SYS_AIO_ERROR = 317 // { int aio_error(struct aiocb *aiocbp); } SYS_YIELD = 321 // { int yield(void); } SYS_MLOCKALL = 324 // { int mlockall(int how); } SYS_MUNLOCKALL = 325 // { int munlockall(void); } - SYS___GETCWD = 326 // { int __getcwd(char *buf, u_int buflen); } + SYS___GETCWD = 326 // { int __getcwd(char *buf, size_t buflen); } SYS_SCHED_SETPARAM = 327 // { int sched_setparam (pid_t pid, const struct sched_param *param); } SYS_SCHED_GETPARAM = 328 // { int sched_getparam (pid_t pid, struct sched_param *param); } SYS_SCHED_SETSCHEDULER = 329 // { int sched_setscheduler (pid_t pid, int policy, const struct sched_param *param); } @@ -226,14 +213,13 @@ const ( SYS___ACL_ACLCHECK_FILE = 353 // { int __acl_aclcheck_file(const char *path, acl_type_t type, struct acl *aclp); } SYS___ACL_ACLCHECK_FD = 354 // { int __acl_aclcheck_fd(int filedes, acl_type_t type, struct acl *aclp); } SYS_EXTATTRCTL = 355 // { int extattrctl(const char *path, int cmd, const char *filename, int attrnamespace, const char *attrname); } - SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FILE = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); } - SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); } + SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete(struct aiocb **aiocbp, struct timespec *timeout); } SYS_GETRESUID = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } SYS_GETRESGID = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } SYS_KQUEUE = 362 // { int kqueue(void); } - SYS_KEVENT = 363 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } SYS_EXTATTR_SET_FD = 371 // { ssize_t extattr_set_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_GET_FD = 372 // { ssize_t extattr_get_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FD = 373 // { int extattr_delete_fd(int fd, int attrnamespace, const char *attrname); } @@ -251,10 +237,6 @@ const ( SYS_UUIDGEN = 392 // { int uuidgen(struct uuid *store, int count); } SYS_SENDFILE = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); } SYS_MAC_SYSCALL = 394 // { int mac_syscall(const char *policy, int call, void *arg); } - SYS_GETFSSTAT = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } - SYS_STATFS = 396 // { int statfs(char *path, struct statfs *buf); } - SYS_FSTATFS = 397 // { int fstatfs(int fd, struct statfs *buf); } - SYS_FHSTATFS = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } SYS_KSEM_CLOSE = 400 // { int ksem_close(semid_t id); } SYS_KSEM_POST = 401 // { int ksem_post(semid_t id); } SYS_KSEM_WAIT = 402 // { int ksem_wait(semid_t id); } @@ -267,14 +249,14 @@ const ( SYS___MAC_GET_PID = 409 // { int __mac_get_pid(pid_t pid, struct mac *mac_p); } SYS___MAC_GET_LINK = 410 // { int __mac_get_link(const char *path_p, struct mac *mac_p); } SYS___MAC_SET_LINK = 411 // { int __mac_set_link(const char *path_p, struct mac *mac_p); } - SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link( const char *path, int attrnamespace, const char *attrname); } + SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link(const char *path, int attrnamespace, const char *attrname); } SYS___MAC_EXECVE = 415 // { int __mac_execve(char *fname, char **argv, char **envv, struct mac *mac_p); } SYS_SIGACTION = 416 // { int sigaction(int sig, const struct sigaction *act, struct sigaction *oact); } - SYS_SIGRETURN = 417 // { int sigreturn( const struct __ucontext *sigcntxp); } + SYS_SIGRETURN = 417 // { int sigreturn(const struct __ucontext *sigcntxp); } SYS_GETCONTEXT = 421 // { int getcontext(struct __ucontext *ucp); } - SYS_SETCONTEXT = 422 // { int setcontext( const struct __ucontext *ucp); } + SYS_SETCONTEXT = 422 // { int setcontext(const struct __ucontext *ucp); } SYS_SWAPCONTEXT = 423 // { int swapcontext(struct __ucontext *oucp, const struct __ucontext *ucp); } SYS_SWAPOFF = 424 // { int swapoff(const char *name); } SYS___ACL_GET_LINK = 425 // { int __acl_get_link(const char *path, acl_type_t type, struct acl *aclp); } @@ -288,10 +270,10 @@ const ( SYS_THR_KILL = 433 // { int thr_kill(long id, int sig); } SYS_JAIL_ATTACH = 436 // { int jail_attach(int jid); } SYS_EXTATTR_LIST_FD = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link( const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file(const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link(const char *path, int attrnamespace, void *data, size_t nbytes); } SYS_KSEM_TIMEDWAIT = 441 // { int ksem_timedwait(semid_t id, const struct timespec *abstime); } - SYS_THR_SUSPEND = 442 // { int thr_suspend( const struct timespec *timeout); } + SYS_THR_SUSPEND = 442 // { int thr_suspend(const struct timespec *timeout); } SYS_THR_WAKE = 443 // { int thr_wake(long id); } SYS_KLDUNLOADF = 444 // { int kldunloadf(int fileid, int flags); } SYS_AUDIT = 445 // { int audit(const void *record, u_int length); } @@ -300,17 +282,17 @@ const ( SYS_SETAUID = 448 // { int setauid(uid_t *auid); } SYS_GETAUDIT = 449 // { int getaudit(struct auditinfo *auditinfo); } SYS_SETAUDIT = 450 // { int setaudit(struct auditinfo *auditinfo); } - SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } - SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } SYS_AUDITCTL = 453 // { int auditctl(char *path); } SYS__UMTX_OP = 454 // { int _umtx_op(void *obj, int op, u_long val, void *uaddr1, void *uaddr2); } SYS_THR_NEW = 455 // { int thr_new(struct thr_param *param, int param_size); } SYS_SIGQUEUE = 456 // { int sigqueue(pid_t pid, int signum, void *value); } SYS_KMQ_OPEN = 457 // { int kmq_open(const char *path, int flags, mode_t mode, const struct mq_attr *attr); } - SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } - SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } - SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len,unsigned msg_prio, const struct timespec *abs_timeout);} - SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } + SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } + SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len, unsigned msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } SYS_KMQ_UNLINK = 462 // { int kmq_unlink(const char *path); } SYS_ABORT2 = 463 // { int abort2(const char *why, int nargs, void **args); } SYS_THR_SET_NAME = 464 // { int thr_set_name(long id, const char *name); } @@ -319,7 +301,7 @@ const ( SYS_SCTP_PEELOFF = 471 // { int sctp_peeloff(int sd, uint32_t name); } SYS_SCTP_GENERIC_SENDMSG = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } - SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr * from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } + SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr *from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } SYS_PREAD = 475 // { ssize_t pread(int fd, void *buf, size_t nbyte, off_t offset); } SYS_PWRITE = 476 // { ssize_t pwrite(int fd, const void *buf, size_t nbyte, off_t offset); } SYS_MMAP = 477 // { caddr_t mmap(caddr_t addr, size_t len, int prot, int flags, int fd, off_t pos); } @@ -338,14 +320,12 @@ const ( SYS_FCHMODAT = 490 // { int fchmodat(int fd, char *path, mode_t mode, int flag); } SYS_FCHOWNAT = 491 // { int fchownat(int fd, char *path, uid_t uid, gid_t gid, int flag); } SYS_FEXECVE = 492 // { int fexecve(int fd, char **argv, char **envv); } - SYS_FSTATAT = 493 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } SYS_FUTIMESAT = 494 // { int futimesat(int fd, char *path, struct timeval *times); } SYS_LINKAT = 495 // { int linkat(int fd1, char *path1, int fd2, char *path2, int flag); } SYS_MKDIRAT = 496 // { int mkdirat(int fd, char *path, mode_t mode); } SYS_MKFIFOAT = 497 // { int mkfifoat(int fd, char *path, mode_t mode); } - SYS_MKNODAT = 498 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } SYS_OPENAT = 499 // { int openat(int fd, char *path, int flag, mode_t mode); } - SYS_READLINKAT = 500 // { int readlinkat(int fd, char *path, char *buf, size_t bufsize); } + SYS_READLINKAT = 500 // { ssize_t readlinkat(int fd, char *path, char *buf, size_t bufsize); } SYS_RENAMEAT = 501 // { int renameat(int oldfd, char *old, int newfd, char *new); } SYS_SYMLINKAT = 502 // { int symlinkat(char *path1, int fd, char *path2); } SYS_UNLINKAT = 503 // { int unlinkat(int fd, char *path, int flag); } @@ -391,7 +371,24 @@ const ( SYS_PPOLL = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); } SYS_FUTIMENS = 546 // { int futimens(int fd, struct timespec *times); } SYS_UTIMENSAT = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); } - SYS_NUMA_GETAFFINITY = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); } - SYS_NUMA_SETAFFINITY = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); } SYS_FDATASYNC = 550 // { int fdatasync(int fd); } + SYS_FSTAT = 551 // { int fstat(int fd, struct stat *sb); } + SYS_FSTATAT = 552 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } + SYS_FHSTAT = 553 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } + SYS_GETDIRENTRIES = 554 // { ssize_t getdirentries(int fd, char *buf, size_t count, off_t *basep); } + SYS_STATFS = 555 // { int statfs(char *path, struct statfs *buf); } + SYS_FSTATFS = 556 // { int fstatfs(int fd, struct statfs *buf); } + SYS_GETFSSTAT = 557 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } + SYS_FHSTATFS = 558 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } + SYS_MKNODAT = 559 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } + SYS_KEVENT = 560 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_CPUSET_GETDOMAIN = 561 // { int cpuset_getdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int *policy); } + SYS_CPUSET_SETDOMAIN = 562 // { int cpuset_setdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int policy); } + SYS_GETRANDOM = 563 // { int getrandom(void *buf, size_t buflen, unsigned int flags); } + SYS_GETFHAT = 564 // { int getfhat(int fd, char *path, struct fhandle *fhp, int flags); } + SYS_FHLINK = 565 // { int fhlink(struct fhandle *fhp, const char *to); } + SYS_FHLINKAT = 566 // { int fhlinkat(struct fhandle *fhp, int tofd, const char *to,); } + SYS_FHREADLINK = 567 // { int fhreadlink(struct fhandle *fhp, char *buf, size_t bufsize); } + SYS___SYSCTLBYNAME = 570 // { int __sysctlbyname(const char *name, size_t namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_CLOSE_RANGE = 575 // { int close_range(u_int lowfd, u_int highfd, int flags); } ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go index 61ad5ca3..89dcc427 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go @@ -1,4 +1,4 @@ -// go run mksysnum.go https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master +// go run mksysnum.go https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12 // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd @@ -19,10 +19,9 @@ const ( SYS_UNLINK = 10 // { int unlink(char *path); } SYS_CHDIR = 12 // { int chdir(char *path); } SYS_FCHDIR = 13 // { int fchdir(int fd); } - SYS_MKNOD = 14 // { int mknod(char *path, int mode, int dev); } SYS_CHMOD = 15 // { int chmod(char *path, int mode); } SYS_CHOWN = 16 // { int chown(char *path, int uid, int gid); } - SYS_OBREAK = 17 // { int obreak(char *nsize); } break obreak_args int + SYS_BREAK = 17 // { caddr_t break(char *nsize); } SYS_GETPID = 20 // { pid_t getpid(void); } SYS_MOUNT = 21 // { int mount(char *type, char *path, int flags, caddr_t data); } SYS_UNMOUNT = 22 // { int unmount(char *path, int flags); } @@ -43,7 +42,6 @@ const ( SYS_KILL = 37 // { int kill(int pid, int signum); } SYS_GETPPID = 39 // { pid_t getppid(void); } SYS_DUP = 41 // { int dup(u_int fd); } - SYS_PIPE = 42 // { int pipe(void); } SYS_GETEGID = 43 // { gid_t getegid(void); } SYS_PROFIL = 44 // { int profil(caddr_t samples, size_t size, size_t offset, u_int scale); } SYS_KTRACE = 45 // { int ktrace(const char *fname, int ops, int facs, int pid); } @@ -58,15 +56,14 @@ const ( SYS_SYMLINK = 57 // { int symlink(char *path, char *link); } SYS_READLINK = 58 // { ssize_t readlink(char *path, char *buf, size_t count); } SYS_EXECVE = 59 // { int execve(char *fname, char **argv, char **envv); } - SYS_UMASK = 60 // { int umask(int newmask); } umask umask_args int + SYS_UMASK = 60 // { int umask(int newmask); } SYS_CHROOT = 61 // { int chroot(char *path); } SYS_MSYNC = 65 // { int msync(void *addr, size_t len, int flags); } SYS_VFORK = 66 // { int vfork(void); } SYS_SBRK = 69 // { int sbrk(int incr); } SYS_SSTK = 70 // { int sstk(int incr); } - SYS_OVADVISE = 72 // { int ovadvise(int anom); } vadvise ovadvise_args int SYS_MUNMAP = 73 // { int munmap(void *addr, size_t len); } - SYS_MPROTECT = 74 // { int mprotect(const void *addr, size_t len, int prot); } + SYS_MPROTECT = 74 // { int mprotect(void *addr, size_t len, int prot); } SYS_MADVISE = 75 // { int madvise(void *addr, size_t len, int behav); } SYS_MINCORE = 78 // { int mincore(const void *addr, size_t len, char *vec); } SYS_GETGROUPS = 79 // { int getgroups(u_int gidsetsize, gid_t *gidset); } @@ -124,14 +121,10 @@ const ( SYS_SETGID = 181 // { int setgid(gid_t gid); } SYS_SETEGID = 182 // { int setegid(gid_t egid); } SYS_SETEUID = 183 // { int seteuid(uid_t euid); } - SYS_STAT = 188 // { int stat(char *path, struct stat *ub); } - SYS_FSTAT = 189 // { int fstat(int fd, struct stat *sb); } - SYS_LSTAT = 190 // { int lstat(char *path, struct stat *ub); } SYS_PATHCONF = 191 // { int pathconf(char *path, int name); } SYS_FPATHCONF = 192 // { int fpathconf(int fd, int name); } SYS_GETRLIMIT = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int SYS_SETRLIMIT = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int - SYS_GETDIRENTRIES = 196 // { int getdirentries(int fd, char *buf, u_int count, long *basep); } SYS___SYSCTL = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int SYS_MLOCK = 203 // { int mlock(const void *addr, size_t len); } SYS_MUNLOCK = 204 // { int munlock(const void *addr, size_t len); } @@ -143,12 +136,12 @@ const ( SYS_SEMOP = 222 // { int semop(int semid, struct sembuf *sops, size_t nsops); } SYS_MSGGET = 225 // { int msgget(key_t key, int msgflg); } SYS_MSGSND = 226 // { int msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } - SYS_MSGRCV = 227 // { int msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_MSGRCV = 227 // { ssize_t msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } SYS_SHMAT = 228 // { int shmat(int shmid, const void *shmaddr, int shmflg); } SYS_SHMDT = 230 // { int shmdt(const void *shmaddr); } SYS_SHMGET = 231 // { int shmget(key_t key, size_t size, int shmflg); } SYS_CLOCK_GETTIME = 232 // { int clock_gettime(clockid_t clock_id, struct timespec *tp); } - SYS_CLOCK_SETTIME = 233 // { int clock_settime( clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_SETTIME = 233 // { int clock_settime(clockid_t clock_id, const struct timespec *tp); } SYS_CLOCK_GETRES = 234 // { int clock_getres(clockid_t clock_id, struct timespec *tp); } SYS_KTIMER_CREATE = 235 // { int ktimer_create(clockid_t clock_id, struct sigevent *evp, int *timerid); } SYS_KTIMER_DELETE = 236 // { int ktimer_delete(int timerid); } @@ -157,50 +150,44 @@ const ( SYS_KTIMER_GETOVERRUN = 239 // { int ktimer_getoverrun(int timerid); } SYS_NANOSLEEP = 240 // { int nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } SYS_FFCLOCK_GETCOUNTER = 241 // { int ffclock_getcounter(ffcounter *ffcount); } - SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate( struct ffclock_estimate *cest); } - SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate( struct ffclock_estimate *cest); } + SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate(struct ffclock_estimate *cest); } + SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate(struct ffclock_estimate *cest); } SYS_CLOCK_NANOSLEEP = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); } - SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id,int which, clockid_t *clock_id); } + SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id, int which, clockid_t *clock_id); } SYS_NTP_GETTIME = 248 // { int ntp_gettime(struct ntptimeval *ntvp); } SYS_MINHERIT = 250 // { int minherit(void *addr, size_t len, int inherit); } SYS_RFORK = 251 // { int rfork(int flags); } - SYS_OPENBSD_POLL = 252 // { int openbsd_poll(struct pollfd *fds, u_int nfds, int timeout); } SYS_ISSETUGID = 253 // { int issetugid(void); } SYS_LCHOWN = 254 // { int lchown(char *path, int uid, int gid); } SYS_AIO_READ = 255 // { int aio_read(struct aiocb *aiocbp); } SYS_AIO_WRITE = 256 // { int aio_write(struct aiocb *aiocbp); } - SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb * const *acb_list, int nent, struct sigevent *sig); } - SYS_GETDENTS = 272 // { int getdents(int fd, char *buf, size_t count); } + SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb* const *acb_list, int nent, struct sigevent *sig); } SYS_LCHMOD = 274 // { int lchmod(char *path, mode_t mode); } SYS_LUTIMES = 276 // { int lutimes(char *path, struct timeval *tptr); } - SYS_NSTAT = 278 // { int nstat(char *path, struct nstat *ub); } - SYS_NFSTAT = 279 // { int nfstat(int fd, struct nstat *sb); } - SYS_NLSTAT = 280 // { int nlstat(char *path, struct nstat *ub); } SYS_PREADV = 289 // { ssize_t preadv(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_PWRITEV = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } SYS_FHOPEN = 298 // { int fhopen(const struct fhandle *u_fhp, int flags); } - SYS_FHSTAT = 299 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } SYS_MODNEXT = 300 // { int modnext(int modid); } - SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat *stat); } + SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat* stat); } SYS_MODFNEXT = 302 // { int modfnext(int modid); } SYS_MODFIND = 303 // { int modfind(const char *name); } SYS_KLDLOAD = 304 // { int kldload(const char *file); } SYS_KLDUNLOAD = 305 // { int kldunload(int fileid); } SYS_KLDFIND = 306 // { int kldfind(const char *file); } SYS_KLDNEXT = 307 // { int kldnext(int fileid); } - SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat* stat); } + SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat *stat); } SYS_KLDFIRSTMOD = 309 // { int kldfirstmod(int fileid); } SYS_GETSID = 310 // { int getsid(pid_t pid); } SYS_SETRESUID = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); } SYS_SETRESGID = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); } SYS_AIO_RETURN = 314 // { ssize_t aio_return(struct aiocb *aiocbp); } - SYS_AIO_SUSPEND = 315 // { int aio_suspend( struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } + SYS_AIO_SUSPEND = 315 // { int aio_suspend(struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } SYS_AIO_CANCEL = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); } SYS_AIO_ERROR = 317 // { int aio_error(struct aiocb *aiocbp); } SYS_YIELD = 321 // { int yield(void); } SYS_MLOCKALL = 324 // { int mlockall(int how); } SYS_MUNLOCKALL = 325 // { int munlockall(void); } - SYS___GETCWD = 326 // { int __getcwd(char *buf, u_int buflen); } + SYS___GETCWD = 326 // { int __getcwd(char *buf, size_t buflen); } SYS_SCHED_SETPARAM = 327 // { int sched_setparam (pid_t pid, const struct sched_param *param); } SYS_SCHED_GETPARAM = 328 // { int sched_getparam (pid_t pid, struct sched_param *param); } SYS_SCHED_SETSCHEDULER = 329 // { int sched_setscheduler (pid_t pid, int policy, const struct sched_param *param); } @@ -226,14 +213,13 @@ const ( SYS___ACL_ACLCHECK_FILE = 353 // { int __acl_aclcheck_file(const char *path, acl_type_t type, struct acl *aclp); } SYS___ACL_ACLCHECK_FD = 354 // { int __acl_aclcheck_fd(int filedes, acl_type_t type, struct acl *aclp); } SYS_EXTATTRCTL = 355 // { int extattrctl(const char *path, int cmd, const char *filename, int attrnamespace, const char *attrname); } - SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FILE = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); } - SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete( struct aiocb **aiocbp, struct timespec *timeout); } + SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete(struct aiocb **aiocbp, struct timespec *timeout); } SYS_GETRESUID = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } SYS_GETRESGID = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } SYS_KQUEUE = 362 // { int kqueue(void); } - SYS_KEVENT = 363 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } SYS_EXTATTR_SET_FD = 371 // { ssize_t extattr_set_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_GET_FD = 372 // { ssize_t extattr_get_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } SYS_EXTATTR_DELETE_FD = 373 // { int extattr_delete_fd(int fd, int attrnamespace, const char *attrname); } @@ -251,10 +237,6 @@ const ( SYS_UUIDGEN = 392 // { int uuidgen(struct uuid *store, int count); } SYS_SENDFILE = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); } SYS_MAC_SYSCALL = 394 // { int mac_syscall(const char *policy, int call, void *arg); } - SYS_GETFSSTAT = 395 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } - SYS_STATFS = 396 // { int statfs(char *path, struct statfs *buf); } - SYS_FSTATFS = 397 // { int fstatfs(int fd, struct statfs *buf); } - SYS_FHSTATFS = 398 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } SYS_KSEM_CLOSE = 400 // { int ksem_close(semid_t id); } SYS_KSEM_POST = 401 // { int ksem_post(semid_t id); } SYS_KSEM_WAIT = 402 // { int ksem_wait(semid_t id); } @@ -267,14 +249,14 @@ const ( SYS___MAC_GET_PID = 409 // { int __mac_get_pid(pid_t pid, struct mac *mac_p); } SYS___MAC_GET_LINK = 410 // { int __mac_get_link(const char *path_p, struct mac *mac_p); } SYS___MAC_SET_LINK = 411 // { int __mac_set_link(const char *path_p, struct mac *mac_p); } - SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link( const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } - SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link( const char *path, int attrnamespace, const char *attrname); } + SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link(const char *path, int attrnamespace, const char *attrname); } SYS___MAC_EXECVE = 415 // { int __mac_execve(char *fname, char **argv, char **envv, struct mac *mac_p); } SYS_SIGACTION = 416 // { int sigaction(int sig, const struct sigaction *act, struct sigaction *oact); } - SYS_SIGRETURN = 417 // { int sigreturn( const struct __ucontext *sigcntxp); } + SYS_SIGRETURN = 417 // { int sigreturn(const struct __ucontext *sigcntxp); } SYS_GETCONTEXT = 421 // { int getcontext(struct __ucontext *ucp); } - SYS_SETCONTEXT = 422 // { int setcontext( const struct __ucontext *ucp); } + SYS_SETCONTEXT = 422 // { int setcontext(const struct __ucontext *ucp); } SYS_SWAPCONTEXT = 423 // { int swapcontext(struct __ucontext *oucp, const struct __ucontext *ucp); } SYS_SWAPOFF = 424 // { int swapoff(const char *name); } SYS___ACL_GET_LINK = 425 // { int __acl_get_link(const char *path, acl_type_t type, struct acl *aclp); } @@ -288,10 +270,10 @@ const ( SYS_THR_KILL = 433 // { int thr_kill(long id, int sig); } SYS_JAIL_ATTACH = 436 // { int jail_attach(int jid); } SYS_EXTATTR_LIST_FD = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file( const char *path, int attrnamespace, void *data, size_t nbytes); } - SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link( const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file(const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link(const char *path, int attrnamespace, void *data, size_t nbytes); } SYS_KSEM_TIMEDWAIT = 441 // { int ksem_timedwait(semid_t id, const struct timespec *abstime); } - SYS_THR_SUSPEND = 442 // { int thr_suspend( const struct timespec *timeout); } + SYS_THR_SUSPEND = 442 // { int thr_suspend(const struct timespec *timeout); } SYS_THR_WAKE = 443 // { int thr_wake(long id); } SYS_KLDUNLOADF = 444 // { int kldunloadf(int fileid, int flags); } SYS_AUDIT = 445 // { int audit(const void *record, u_int length); } @@ -300,17 +282,17 @@ const ( SYS_SETAUID = 448 // { int setauid(uid_t *auid); } SYS_GETAUDIT = 449 // { int getaudit(struct auditinfo *auditinfo); } SYS_SETAUDIT = 450 // { int setaudit(struct auditinfo *auditinfo); } - SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } - SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr( struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } SYS_AUDITCTL = 453 // { int auditctl(char *path); } SYS__UMTX_OP = 454 // { int _umtx_op(void *obj, int op, u_long val, void *uaddr1, void *uaddr2); } SYS_THR_NEW = 455 // { int thr_new(struct thr_param *param, int param_size); } SYS_SIGQUEUE = 456 // { int sigqueue(pid_t pid, int signum, void *value); } SYS_KMQ_OPEN = 457 // { int kmq_open(const char *path, int flags, mode_t mode, const struct mq_attr *attr); } - SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } - SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } - SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len,unsigned msg_prio, const struct timespec *abs_timeout);} - SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } + SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } + SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len, unsigned msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } SYS_KMQ_UNLINK = 462 // { int kmq_unlink(const char *path); } SYS_ABORT2 = 463 // { int abort2(const char *why, int nargs, void **args); } SYS_THR_SET_NAME = 464 // { int thr_set_name(long id, const char *name); } @@ -319,7 +301,7 @@ const ( SYS_SCTP_PEELOFF = 471 // { int sctp_peeloff(int sd, uint32_t name); } SYS_SCTP_GENERIC_SENDMSG = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } - SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr * from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } + SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr *from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } SYS_PREAD = 475 // { ssize_t pread(int fd, void *buf, size_t nbyte, off_t offset); } SYS_PWRITE = 476 // { ssize_t pwrite(int fd, const void *buf, size_t nbyte, off_t offset); } SYS_MMAP = 477 // { caddr_t mmap(caddr_t addr, size_t len, int prot, int flags, int fd, off_t pos); } @@ -338,14 +320,12 @@ const ( SYS_FCHMODAT = 490 // { int fchmodat(int fd, char *path, mode_t mode, int flag); } SYS_FCHOWNAT = 491 // { int fchownat(int fd, char *path, uid_t uid, gid_t gid, int flag); } SYS_FEXECVE = 492 // { int fexecve(int fd, char **argv, char **envv); } - SYS_FSTATAT = 493 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } SYS_FUTIMESAT = 494 // { int futimesat(int fd, char *path, struct timeval *times); } SYS_LINKAT = 495 // { int linkat(int fd1, char *path1, int fd2, char *path2, int flag); } SYS_MKDIRAT = 496 // { int mkdirat(int fd, char *path, mode_t mode); } SYS_MKFIFOAT = 497 // { int mkfifoat(int fd, char *path, mode_t mode); } - SYS_MKNODAT = 498 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } SYS_OPENAT = 499 // { int openat(int fd, char *path, int flag, mode_t mode); } - SYS_READLINKAT = 500 // { int readlinkat(int fd, char *path, char *buf, size_t bufsize); } + SYS_READLINKAT = 500 // { ssize_t readlinkat(int fd, char *path, char *buf, size_t bufsize); } SYS_RENAMEAT = 501 // { int renameat(int oldfd, char *old, int newfd, char *new); } SYS_SYMLINKAT = 502 // { int symlinkat(char *path1, int fd, char *path2); } SYS_UNLINKAT = 503 // { int unlinkat(int fd, char *path, int flag); } @@ -391,7 +371,24 @@ const ( SYS_PPOLL = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); } SYS_FUTIMENS = 546 // { int futimens(int fd, struct timespec *times); } SYS_UTIMENSAT = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); } - SYS_NUMA_GETAFFINITY = 548 // { int numa_getaffinity(cpuwhich_t which, id_t id, struct vm_domain_policy_entry *policy); } - SYS_NUMA_SETAFFINITY = 549 // { int numa_setaffinity(cpuwhich_t which, id_t id, const struct vm_domain_policy_entry *policy); } SYS_FDATASYNC = 550 // { int fdatasync(int fd); } + SYS_FSTAT = 551 // { int fstat(int fd, struct stat *sb); } + SYS_FSTATAT = 552 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } + SYS_FHSTAT = 553 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } + SYS_GETDIRENTRIES = 554 // { ssize_t getdirentries(int fd, char *buf, size_t count, off_t *basep); } + SYS_STATFS = 555 // { int statfs(char *path, struct statfs *buf); } + SYS_FSTATFS = 556 // { int fstatfs(int fd, struct statfs *buf); } + SYS_GETFSSTAT = 557 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } + SYS_FHSTATFS = 558 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } + SYS_MKNODAT = 559 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } + SYS_KEVENT = 560 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_CPUSET_GETDOMAIN = 561 // { int cpuset_getdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int *policy); } + SYS_CPUSET_SETDOMAIN = 562 // { int cpuset_setdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int policy); } + SYS_GETRANDOM = 563 // { int getrandom(void *buf, size_t buflen, unsigned int flags); } + SYS_GETFHAT = 564 // { int getfhat(int fd, char *path, struct fhandle *fhp, int flags); } + SYS_FHLINK = 565 // { int fhlink(struct fhandle *fhp, const char *to); } + SYS_FHLINKAT = 566 // { int fhlinkat(struct fhandle *fhp, int tofd, const char *to,); } + SYS_FHREADLINK = 567 // { int fhreadlink(struct fhandle *fhp, char *buf, size_t bufsize); } + SYS___SYSCTLBYNAME = 570 // { int __sysctlbyname(const char *name, size_t namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_CLOSE_RANGE = 575 // { int close_range(u_int lowfd, u_int highfd, int flags); } ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go new file mode 100644 index 00000000..ee37aaa0 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go @@ -0,0 +1,394 @@ +// go run mksysnum.go https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12 +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && freebsd +// +build riscv64,freebsd + +package unix + +const ( + // SYS_NOSYS = 0; // { int nosys(void); } syscall nosys_args int + SYS_EXIT = 1 // { void sys_exit(int rval); } exit sys_exit_args void + SYS_FORK = 2 // { int fork(void); } + SYS_READ = 3 // { ssize_t read(int fd, void *buf, size_t nbyte); } + SYS_WRITE = 4 // { ssize_t write(int fd, const void *buf, size_t nbyte); } + SYS_OPEN = 5 // { int open(char *path, int flags, int mode); } + SYS_CLOSE = 6 // { int close(int fd); } + SYS_WAIT4 = 7 // { int wait4(int pid, int *status, int options, struct rusage *rusage); } + SYS_LINK = 9 // { int link(char *path, char *link); } + SYS_UNLINK = 10 // { int unlink(char *path); } + SYS_CHDIR = 12 // { int chdir(char *path); } + SYS_FCHDIR = 13 // { int fchdir(int fd); } + SYS_CHMOD = 15 // { int chmod(char *path, int mode); } + SYS_CHOWN = 16 // { int chown(char *path, int uid, int gid); } + SYS_BREAK = 17 // { caddr_t break(char *nsize); } + SYS_GETPID = 20 // { pid_t getpid(void); } + SYS_MOUNT = 21 // { int mount(char *type, char *path, int flags, caddr_t data); } + SYS_UNMOUNT = 22 // { int unmount(char *path, int flags); } + SYS_SETUID = 23 // { int setuid(uid_t uid); } + SYS_GETUID = 24 // { uid_t getuid(void); } + SYS_GETEUID = 25 // { uid_t geteuid(void); } + SYS_PTRACE = 26 // { int ptrace(int req, pid_t pid, caddr_t addr, int data); } + SYS_RECVMSG = 27 // { int recvmsg(int s, struct msghdr *msg, int flags); } + SYS_SENDMSG = 28 // { int sendmsg(int s, struct msghdr *msg, int flags); } + SYS_RECVFROM = 29 // { int recvfrom(int s, caddr_t buf, size_t len, int flags, struct sockaddr * __restrict from, __socklen_t * __restrict fromlenaddr); } + SYS_ACCEPT = 30 // { int accept(int s, struct sockaddr * __restrict name, __socklen_t * __restrict anamelen); } + SYS_GETPEERNAME = 31 // { int getpeername(int fdes, struct sockaddr * __restrict asa, __socklen_t * __restrict alen); } + SYS_GETSOCKNAME = 32 // { int getsockname(int fdes, struct sockaddr * __restrict asa, __socklen_t * __restrict alen); } + SYS_ACCESS = 33 // { int access(char *path, int amode); } + SYS_CHFLAGS = 34 // { int chflags(const char *path, u_long flags); } + SYS_FCHFLAGS = 35 // { int fchflags(int fd, u_long flags); } + SYS_SYNC = 36 // { int sync(void); } + SYS_KILL = 37 // { int kill(int pid, int signum); } + SYS_GETPPID = 39 // { pid_t getppid(void); } + SYS_DUP = 41 // { int dup(u_int fd); } + SYS_GETEGID = 43 // { gid_t getegid(void); } + SYS_PROFIL = 44 // { int profil(caddr_t samples, size_t size, size_t offset, u_int scale); } + SYS_KTRACE = 45 // { int ktrace(const char *fname, int ops, int facs, int pid); } + SYS_GETGID = 47 // { gid_t getgid(void); } + SYS_GETLOGIN = 49 // { int getlogin(char *namebuf, u_int namelen); } + SYS_SETLOGIN = 50 // { int setlogin(char *namebuf); } + SYS_ACCT = 51 // { int acct(char *path); } + SYS_SIGALTSTACK = 53 // { int sigaltstack(stack_t *ss, stack_t *oss); } + SYS_IOCTL = 54 // { int ioctl(int fd, u_long com, caddr_t data); } + SYS_REBOOT = 55 // { int reboot(int opt); } + SYS_REVOKE = 56 // { int revoke(char *path); } + SYS_SYMLINK = 57 // { int symlink(char *path, char *link); } + SYS_READLINK = 58 // { ssize_t readlink(char *path, char *buf, size_t count); } + SYS_EXECVE = 59 // { int execve(char *fname, char **argv, char **envv); } + SYS_UMASK = 60 // { int umask(int newmask); } + SYS_CHROOT = 61 // { int chroot(char *path); } + SYS_MSYNC = 65 // { int msync(void *addr, size_t len, int flags); } + SYS_VFORK = 66 // { int vfork(void); } + SYS_SBRK = 69 // { int sbrk(int incr); } + SYS_SSTK = 70 // { int sstk(int incr); } + SYS_MUNMAP = 73 // { int munmap(void *addr, size_t len); } + SYS_MPROTECT = 74 // { int mprotect(void *addr, size_t len, int prot); } + SYS_MADVISE = 75 // { int madvise(void *addr, size_t len, int behav); } + SYS_MINCORE = 78 // { int mincore(const void *addr, size_t len, char *vec); } + SYS_GETGROUPS = 79 // { int getgroups(u_int gidsetsize, gid_t *gidset); } + SYS_SETGROUPS = 80 // { int setgroups(u_int gidsetsize, gid_t *gidset); } + SYS_GETPGRP = 81 // { int getpgrp(void); } + SYS_SETPGID = 82 // { int setpgid(int pid, int pgid); } + SYS_SETITIMER = 83 // { int setitimer(u_int which, struct itimerval *itv, struct itimerval *oitv); } + SYS_SWAPON = 85 // { int swapon(char *name); } + SYS_GETITIMER = 86 // { int getitimer(u_int which, struct itimerval *itv); } + SYS_GETDTABLESIZE = 89 // { int getdtablesize(void); } + SYS_DUP2 = 90 // { int dup2(u_int from, u_int to); } + SYS_FCNTL = 92 // { int fcntl(int fd, int cmd, long arg); } + SYS_SELECT = 93 // { int select(int nd, fd_set *in, fd_set *ou, fd_set *ex, struct timeval *tv); } + SYS_FSYNC = 95 // { int fsync(int fd); } + SYS_SETPRIORITY = 96 // { int setpriority(int which, int who, int prio); } + SYS_SOCKET = 97 // { int socket(int domain, int type, int protocol); } + SYS_CONNECT = 98 // { int connect(int s, caddr_t name, int namelen); } + SYS_GETPRIORITY = 100 // { int getpriority(int which, int who); } + SYS_BIND = 104 // { int bind(int s, caddr_t name, int namelen); } + SYS_SETSOCKOPT = 105 // { int setsockopt(int s, int level, int name, caddr_t val, int valsize); } + SYS_LISTEN = 106 // { int listen(int s, int backlog); } + SYS_GETTIMEOFDAY = 116 // { int gettimeofday(struct timeval *tp, struct timezone *tzp); } + SYS_GETRUSAGE = 117 // { int getrusage(int who, struct rusage *rusage); } + SYS_GETSOCKOPT = 118 // { int getsockopt(int s, int level, int name, caddr_t val, int *avalsize); } + SYS_READV = 120 // { int readv(int fd, struct iovec *iovp, u_int iovcnt); } + SYS_WRITEV = 121 // { int writev(int fd, struct iovec *iovp, u_int iovcnt); } + SYS_SETTIMEOFDAY = 122 // { int settimeofday(struct timeval *tv, struct timezone *tzp); } + SYS_FCHOWN = 123 // { int fchown(int fd, int uid, int gid); } + SYS_FCHMOD = 124 // { int fchmod(int fd, int mode); } + SYS_SETREUID = 126 // { int setreuid(int ruid, int euid); } + SYS_SETREGID = 127 // { int setregid(int rgid, int egid); } + SYS_RENAME = 128 // { int rename(char *from, char *to); } + SYS_FLOCK = 131 // { int flock(int fd, int how); } + SYS_MKFIFO = 132 // { int mkfifo(char *path, int mode); } + SYS_SENDTO = 133 // { int sendto(int s, caddr_t buf, size_t len, int flags, caddr_t to, int tolen); } + SYS_SHUTDOWN = 134 // { int shutdown(int s, int how); } + SYS_SOCKETPAIR = 135 // { int socketpair(int domain, int type, int protocol, int *rsv); } + SYS_MKDIR = 136 // { int mkdir(char *path, int mode); } + SYS_RMDIR = 137 // { int rmdir(char *path); } + SYS_UTIMES = 138 // { int utimes(char *path, struct timeval *tptr); } + SYS_ADJTIME = 140 // { int adjtime(struct timeval *delta, struct timeval *olddelta); } + SYS_SETSID = 147 // { int setsid(void); } + SYS_QUOTACTL = 148 // { int quotactl(char *path, int cmd, int uid, caddr_t arg); } + SYS_NLM_SYSCALL = 154 // { int nlm_syscall(int debug_level, int grace_period, int addr_count, char **addrs); } + SYS_NFSSVC = 155 // { int nfssvc(int flag, caddr_t argp); } + SYS_LGETFH = 160 // { int lgetfh(char *fname, struct fhandle *fhp); } + SYS_GETFH = 161 // { int getfh(char *fname, struct fhandle *fhp); } + SYS_SYSARCH = 165 // { int sysarch(int op, char *parms); } + SYS_RTPRIO = 166 // { int rtprio(int function, pid_t pid, struct rtprio *rtp); } + SYS_SEMSYS = 169 // { int semsys(int which, int a2, int a3, int a4, int a5); } + SYS_MSGSYS = 170 // { int msgsys(int which, int a2, int a3, int a4, int a5, int a6); } + SYS_SHMSYS = 171 // { int shmsys(int which, int a2, int a3, int a4); } + SYS_SETFIB = 175 // { int setfib(int fibnum); } + SYS_NTP_ADJTIME = 176 // { int ntp_adjtime(struct timex *tp); } + SYS_SETGID = 181 // { int setgid(gid_t gid); } + SYS_SETEGID = 182 // { int setegid(gid_t egid); } + SYS_SETEUID = 183 // { int seteuid(uid_t euid); } + SYS_PATHCONF = 191 // { int pathconf(char *path, int name); } + SYS_FPATHCONF = 192 // { int fpathconf(int fd, int name); } + SYS_GETRLIMIT = 194 // { int getrlimit(u_int which, struct rlimit *rlp); } getrlimit __getrlimit_args int + SYS_SETRLIMIT = 195 // { int setrlimit(u_int which, struct rlimit *rlp); } setrlimit __setrlimit_args int + SYS___SYSCTL = 202 // { int __sysctl(int *name, u_int namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } __sysctl sysctl_args int + SYS_MLOCK = 203 // { int mlock(const void *addr, size_t len); } + SYS_MUNLOCK = 204 // { int munlock(const void *addr, size_t len); } + SYS_UNDELETE = 205 // { int undelete(char *path); } + SYS_FUTIMES = 206 // { int futimes(int fd, struct timeval *tptr); } + SYS_GETPGID = 207 // { int getpgid(pid_t pid); } + SYS_POLL = 209 // { int poll(struct pollfd *fds, u_int nfds, int timeout); } + SYS_SEMGET = 221 // { int semget(key_t key, int nsems, int semflg); } + SYS_SEMOP = 222 // { int semop(int semid, struct sembuf *sops, size_t nsops); } + SYS_MSGGET = 225 // { int msgget(key_t key, int msgflg); } + SYS_MSGSND = 226 // { int msgsnd(int msqid, const void *msgp, size_t msgsz, int msgflg); } + SYS_MSGRCV = 227 // { ssize_t msgrcv(int msqid, void *msgp, size_t msgsz, long msgtyp, int msgflg); } + SYS_SHMAT = 228 // { int shmat(int shmid, const void *shmaddr, int shmflg); } + SYS_SHMDT = 230 // { int shmdt(const void *shmaddr); } + SYS_SHMGET = 231 // { int shmget(key_t key, size_t size, int shmflg); } + SYS_CLOCK_GETTIME = 232 // { int clock_gettime(clockid_t clock_id, struct timespec *tp); } + SYS_CLOCK_SETTIME = 233 // { int clock_settime(clockid_t clock_id, const struct timespec *tp); } + SYS_CLOCK_GETRES = 234 // { int clock_getres(clockid_t clock_id, struct timespec *tp); } + SYS_KTIMER_CREATE = 235 // { int ktimer_create(clockid_t clock_id, struct sigevent *evp, int *timerid); } + SYS_KTIMER_DELETE = 236 // { int ktimer_delete(int timerid); } + SYS_KTIMER_SETTIME = 237 // { int ktimer_settime(int timerid, int flags, const struct itimerspec *value, struct itimerspec *ovalue); } + SYS_KTIMER_GETTIME = 238 // { int ktimer_gettime(int timerid, struct itimerspec *value); } + SYS_KTIMER_GETOVERRUN = 239 // { int ktimer_getoverrun(int timerid); } + SYS_NANOSLEEP = 240 // { int nanosleep(const struct timespec *rqtp, struct timespec *rmtp); } + SYS_FFCLOCK_GETCOUNTER = 241 // { int ffclock_getcounter(ffcounter *ffcount); } + SYS_FFCLOCK_SETESTIMATE = 242 // { int ffclock_setestimate(struct ffclock_estimate *cest); } + SYS_FFCLOCK_GETESTIMATE = 243 // { int ffclock_getestimate(struct ffclock_estimate *cest); } + SYS_CLOCK_NANOSLEEP = 244 // { int clock_nanosleep(clockid_t clock_id, int flags, const struct timespec *rqtp, struct timespec *rmtp); } + SYS_CLOCK_GETCPUCLOCKID2 = 247 // { int clock_getcpuclockid2(id_t id, int which, clockid_t *clock_id); } + SYS_NTP_GETTIME = 248 // { int ntp_gettime(struct ntptimeval *ntvp); } + SYS_MINHERIT = 250 // { int minherit(void *addr, size_t len, int inherit); } + SYS_RFORK = 251 // { int rfork(int flags); } + SYS_ISSETUGID = 253 // { int issetugid(void); } + SYS_LCHOWN = 254 // { int lchown(char *path, int uid, int gid); } + SYS_AIO_READ = 255 // { int aio_read(struct aiocb *aiocbp); } + SYS_AIO_WRITE = 256 // { int aio_write(struct aiocb *aiocbp); } + SYS_LIO_LISTIO = 257 // { int lio_listio(int mode, struct aiocb* const *acb_list, int nent, struct sigevent *sig); } + SYS_LCHMOD = 274 // { int lchmod(char *path, mode_t mode); } + SYS_LUTIMES = 276 // { int lutimes(char *path, struct timeval *tptr); } + SYS_PREADV = 289 // { ssize_t preadv(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } + SYS_PWRITEV = 290 // { ssize_t pwritev(int fd, struct iovec *iovp, u_int iovcnt, off_t offset); } + SYS_FHOPEN = 298 // { int fhopen(const struct fhandle *u_fhp, int flags); } + SYS_MODNEXT = 300 // { int modnext(int modid); } + SYS_MODSTAT = 301 // { int modstat(int modid, struct module_stat* stat); } + SYS_MODFNEXT = 302 // { int modfnext(int modid); } + SYS_MODFIND = 303 // { int modfind(const char *name); } + SYS_KLDLOAD = 304 // { int kldload(const char *file); } + SYS_KLDUNLOAD = 305 // { int kldunload(int fileid); } + SYS_KLDFIND = 306 // { int kldfind(const char *file); } + SYS_KLDNEXT = 307 // { int kldnext(int fileid); } + SYS_KLDSTAT = 308 // { int kldstat(int fileid, struct kld_file_stat *stat); } + SYS_KLDFIRSTMOD = 309 // { int kldfirstmod(int fileid); } + SYS_GETSID = 310 // { int getsid(pid_t pid); } + SYS_SETRESUID = 311 // { int setresuid(uid_t ruid, uid_t euid, uid_t suid); } + SYS_SETRESGID = 312 // { int setresgid(gid_t rgid, gid_t egid, gid_t sgid); } + SYS_AIO_RETURN = 314 // { ssize_t aio_return(struct aiocb *aiocbp); } + SYS_AIO_SUSPEND = 315 // { int aio_suspend(struct aiocb * const * aiocbp, int nent, const struct timespec *timeout); } + SYS_AIO_CANCEL = 316 // { int aio_cancel(int fd, struct aiocb *aiocbp); } + SYS_AIO_ERROR = 317 // { int aio_error(struct aiocb *aiocbp); } + SYS_YIELD = 321 // { int yield(void); } + SYS_MLOCKALL = 324 // { int mlockall(int how); } + SYS_MUNLOCKALL = 325 // { int munlockall(void); } + SYS___GETCWD = 326 // { int __getcwd(char *buf, size_t buflen); } + SYS_SCHED_SETPARAM = 327 // { int sched_setparam (pid_t pid, const struct sched_param *param); } + SYS_SCHED_GETPARAM = 328 // { int sched_getparam (pid_t pid, struct sched_param *param); } + SYS_SCHED_SETSCHEDULER = 329 // { int sched_setscheduler (pid_t pid, int policy, const struct sched_param *param); } + SYS_SCHED_GETSCHEDULER = 330 // { int sched_getscheduler (pid_t pid); } + SYS_SCHED_YIELD = 331 // { int sched_yield (void); } + SYS_SCHED_GET_PRIORITY_MAX = 332 // { int sched_get_priority_max (int policy); } + SYS_SCHED_GET_PRIORITY_MIN = 333 // { int sched_get_priority_min (int policy); } + SYS_SCHED_RR_GET_INTERVAL = 334 // { int sched_rr_get_interval (pid_t pid, struct timespec *interval); } + SYS_UTRACE = 335 // { int utrace(const void *addr, size_t len); } + SYS_KLDSYM = 337 // { int kldsym(int fileid, int cmd, void *data); } + SYS_JAIL = 338 // { int jail(struct jail *jail); } + SYS_SIGPROCMASK = 340 // { int sigprocmask(int how, const sigset_t *set, sigset_t *oset); } + SYS_SIGSUSPEND = 341 // { int sigsuspend(const sigset_t *sigmask); } + SYS_SIGPENDING = 343 // { int sigpending(sigset_t *set); } + SYS_SIGTIMEDWAIT = 345 // { int sigtimedwait(const sigset_t *set, siginfo_t *info, const struct timespec *timeout); } + SYS_SIGWAITINFO = 346 // { int sigwaitinfo(const sigset_t *set, siginfo_t *info); } + SYS___ACL_GET_FILE = 347 // { int __acl_get_file(const char *path, acl_type_t type, struct acl *aclp); } + SYS___ACL_SET_FILE = 348 // { int __acl_set_file(const char *path, acl_type_t type, struct acl *aclp); } + SYS___ACL_GET_FD = 349 // { int __acl_get_fd(int filedes, acl_type_t type, struct acl *aclp); } + SYS___ACL_SET_FD = 350 // { int __acl_set_fd(int filedes, acl_type_t type, struct acl *aclp); } + SYS___ACL_DELETE_FILE = 351 // { int __acl_delete_file(const char *path, acl_type_t type); } + SYS___ACL_DELETE_FD = 352 // { int __acl_delete_fd(int filedes, acl_type_t type); } + SYS___ACL_ACLCHECK_FILE = 353 // { int __acl_aclcheck_file(const char *path, acl_type_t type, struct acl *aclp); } + SYS___ACL_ACLCHECK_FD = 354 // { int __acl_aclcheck_fd(int filedes, acl_type_t type, struct acl *aclp); } + SYS_EXTATTRCTL = 355 // { int extattrctl(const char *path, int cmd, const char *filename, int attrnamespace, const char *attrname); } + SYS_EXTATTR_SET_FILE = 356 // { ssize_t extattr_set_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_FILE = 357 // { ssize_t extattr_get_file(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_FILE = 358 // { int extattr_delete_file(const char *path, int attrnamespace, const char *attrname); } + SYS_AIO_WAITCOMPLETE = 359 // { ssize_t aio_waitcomplete(struct aiocb **aiocbp, struct timespec *timeout); } + SYS_GETRESUID = 360 // { int getresuid(uid_t *ruid, uid_t *euid, uid_t *suid); } + SYS_GETRESGID = 361 // { int getresgid(gid_t *rgid, gid_t *egid, gid_t *sgid); } + SYS_KQUEUE = 362 // { int kqueue(void); } + SYS_EXTATTR_SET_FD = 371 // { ssize_t extattr_set_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_FD = 372 // { ssize_t extattr_get_fd(int fd, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_FD = 373 // { int extattr_delete_fd(int fd, int attrnamespace, const char *attrname); } + SYS___SETUGID = 374 // { int __setugid(int flag); } + SYS_EACCESS = 376 // { int eaccess(char *path, int amode); } + SYS_NMOUNT = 378 // { int nmount(struct iovec *iovp, unsigned int iovcnt, int flags); } + SYS___MAC_GET_PROC = 384 // { int __mac_get_proc(struct mac *mac_p); } + SYS___MAC_SET_PROC = 385 // { int __mac_set_proc(struct mac *mac_p); } + SYS___MAC_GET_FD = 386 // { int __mac_get_fd(int fd, struct mac *mac_p); } + SYS___MAC_GET_FILE = 387 // { int __mac_get_file(const char *path_p, struct mac *mac_p); } + SYS___MAC_SET_FD = 388 // { int __mac_set_fd(int fd, struct mac *mac_p); } + SYS___MAC_SET_FILE = 389 // { int __mac_set_file(const char *path_p, struct mac *mac_p); } + SYS_KENV = 390 // { int kenv(int what, const char *name, char *value, int len); } + SYS_LCHFLAGS = 391 // { int lchflags(const char *path, u_long flags); } + SYS_UUIDGEN = 392 // { int uuidgen(struct uuid *store, int count); } + SYS_SENDFILE = 393 // { int sendfile(int fd, int s, off_t offset, size_t nbytes, struct sf_hdtr *hdtr, off_t *sbytes, int flags); } + SYS_MAC_SYSCALL = 394 // { int mac_syscall(const char *policy, int call, void *arg); } + SYS_KSEM_CLOSE = 400 // { int ksem_close(semid_t id); } + SYS_KSEM_POST = 401 // { int ksem_post(semid_t id); } + SYS_KSEM_WAIT = 402 // { int ksem_wait(semid_t id); } + SYS_KSEM_TRYWAIT = 403 // { int ksem_trywait(semid_t id); } + SYS_KSEM_INIT = 404 // { int ksem_init(semid_t *idp, unsigned int value); } + SYS_KSEM_OPEN = 405 // { int ksem_open(semid_t *idp, const char *name, int oflag, mode_t mode, unsigned int value); } + SYS_KSEM_UNLINK = 406 // { int ksem_unlink(const char *name); } + SYS_KSEM_GETVALUE = 407 // { int ksem_getvalue(semid_t id, int *val); } + SYS_KSEM_DESTROY = 408 // { int ksem_destroy(semid_t id); } + SYS___MAC_GET_PID = 409 // { int __mac_get_pid(pid_t pid, struct mac *mac_p); } + SYS___MAC_GET_LINK = 410 // { int __mac_get_link(const char *path_p, struct mac *mac_p); } + SYS___MAC_SET_LINK = 411 // { int __mac_set_link(const char *path_p, struct mac *mac_p); } + SYS_EXTATTR_SET_LINK = 412 // { ssize_t extattr_set_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_GET_LINK = 413 // { ssize_t extattr_get_link(const char *path, int attrnamespace, const char *attrname, void *data, size_t nbytes); } + SYS_EXTATTR_DELETE_LINK = 414 // { int extattr_delete_link(const char *path, int attrnamespace, const char *attrname); } + SYS___MAC_EXECVE = 415 // { int __mac_execve(char *fname, char **argv, char **envv, struct mac *mac_p); } + SYS_SIGACTION = 416 // { int sigaction(int sig, const struct sigaction *act, struct sigaction *oact); } + SYS_SIGRETURN = 417 // { int sigreturn(const struct __ucontext *sigcntxp); } + SYS_GETCONTEXT = 421 // { int getcontext(struct __ucontext *ucp); } + SYS_SETCONTEXT = 422 // { int setcontext(const struct __ucontext *ucp); } + SYS_SWAPCONTEXT = 423 // { int swapcontext(struct __ucontext *oucp, const struct __ucontext *ucp); } + SYS_SWAPOFF = 424 // { int swapoff(const char *name); } + SYS___ACL_GET_LINK = 425 // { int __acl_get_link(const char *path, acl_type_t type, struct acl *aclp); } + SYS___ACL_SET_LINK = 426 // { int __acl_set_link(const char *path, acl_type_t type, struct acl *aclp); } + SYS___ACL_DELETE_LINK = 427 // { int __acl_delete_link(const char *path, acl_type_t type); } + SYS___ACL_ACLCHECK_LINK = 428 // { int __acl_aclcheck_link(const char *path, acl_type_t type, struct acl *aclp); } + SYS_SIGWAIT = 429 // { int sigwait(const sigset_t *set, int *sig); } + SYS_THR_CREATE = 430 // { int thr_create(ucontext_t *ctx, long *id, int flags); } + SYS_THR_EXIT = 431 // { void thr_exit(long *state); } + SYS_THR_SELF = 432 // { int thr_self(long *id); } + SYS_THR_KILL = 433 // { int thr_kill(long id, int sig); } + SYS_JAIL_ATTACH = 436 // { int jail_attach(int jid); } + SYS_EXTATTR_LIST_FD = 437 // { ssize_t extattr_list_fd(int fd, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_FILE = 438 // { ssize_t extattr_list_file(const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_EXTATTR_LIST_LINK = 439 // { ssize_t extattr_list_link(const char *path, int attrnamespace, void *data, size_t nbytes); } + SYS_KSEM_TIMEDWAIT = 441 // { int ksem_timedwait(semid_t id, const struct timespec *abstime); } + SYS_THR_SUSPEND = 442 // { int thr_suspend(const struct timespec *timeout); } + SYS_THR_WAKE = 443 // { int thr_wake(long id); } + SYS_KLDUNLOADF = 444 // { int kldunloadf(int fileid, int flags); } + SYS_AUDIT = 445 // { int audit(const void *record, u_int length); } + SYS_AUDITON = 446 // { int auditon(int cmd, void *data, u_int length); } + SYS_GETAUID = 447 // { int getauid(uid_t *auid); } + SYS_SETAUID = 448 // { int setauid(uid_t *auid); } + SYS_GETAUDIT = 449 // { int getaudit(struct auditinfo *auditinfo); } + SYS_SETAUDIT = 450 // { int setaudit(struct auditinfo *auditinfo); } + SYS_GETAUDIT_ADDR = 451 // { int getaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_SETAUDIT_ADDR = 452 // { int setaudit_addr(struct auditinfo_addr *auditinfo_addr, u_int length); } + SYS_AUDITCTL = 453 // { int auditctl(char *path); } + SYS__UMTX_OP = 454 // { int _umtx_op(void *obj, int op, u_long val, void *uaddr1, void *uaddr2); } + SYS_THR_NEW = 455 // { int thr_new(struct thr_param *param, int param_size); } + SYS_SIGQUEUE = 456 // { int sigqueue(pid_t pid, int signum, void *value); } + SYS_KMQ_OPEN = 457 // { int kmq_open(const char *path, int flags, mode_t mode, const struct mq_attr *attr); } + SYS_KMQ_SETATTR = 458 // { int kmq_setattr(int mqd, const struct mq_attr *attr, struct mq_attr *oattr); } + SYS_KMQ_TIMEDRECEIVE = 459 // { int kmq_timedreceive(int mqd, char *msg_ptr, size_t msg_len, unsigned *msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_TIMEDSEND = 460 // { int kmq_timedsend(int mqd, const char *msg_ptr, size_t msg_len, unsigned msg_prio, const struct timespec *abs_timeout); } + SYS_KMQ_NOTIFY = 461 // { int kmq_notify(int mqd, const struct sigevent *sigev); } + SYS_KMQ_UNLINK = 462 // { int kmq_unlink(const char *path); } + SYS_ABORT2 = 463 // { int abort2(const char *why, int nargs, void **args); } + SYS_THR_SET_NAME = 464 // { int thr_set_name(long id, const char *name); } + SYS_AIO_FSYNC = 465 // { int aio_fsync(int op, struct aiocb *aiocbp); } + SYS_RTPRIO_THREAD = 466 // { int rtprio_thread(int function, lwpid_t lwpid, struct rtprio *rtp); } + SYS_SCTP_PEELOFF = 471 // { int sctp_peeloff(int sd, uint32_t name); } + SYS_SCTP_GENERIC_SENDMSG = 472 // { int sctp_generic_sendmsg(int sd, caddr_t msg, int mlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } + SYS_SCTP_GENERIC_SENDMSG_IOV = 473 // { int sctp_generic_sendmsg_iov(int sd, struct iovec *iov, int iovlen, caddr_t to, __socklen_t tolen, struct sctp_sndrcvinfo *sinfo, int flags); } + SYS_SCTP_GENERIC_RECVMSG = 474 // { int sctp_generic_recvmsg(int sd, struct iovec *iov, int iovlen, struct sockaddr *from, __socklen_t *fromlenaddr, struct sctp_sndrcvinfo *sinfo, int *msg_flags); } + SYS_PREAD = 475 // { ssize_t pread(int fd, void *buf, size_t nbyte, off_t offset); } + SYS_PWRITE = 476 // { ssize_t pwrite(int fd, const void *buf, size_t nbyte, off_t offset); } + SYS_MMAP = 477 // { caddr_t mmap(caddr_t addr, size_t len, int prot, int flags, int fd, off_t pos); } + SYS_LSEEK = 478 // { off_t lseek(int fd, off_t offset, int whence); } + SYS_TRUNCATE = 479 // { int truncate(char *path, off_t length); } + SYS_FTRUNCATE = 480 // { int ftruncate(int fd, off_t length); } + SYS_THR_KILL2 = 481 // { int thr_kill2(pid_t pid, long id, int sig); } + SYS_SHM_OPEN = 482 // { int shm_open(const char *path, int flags, mode_t mode); } + SYS_SHM_UNLINK = 483 // { int shm_unlink(const char *path); } + SYS_CPUSET = 484 // { int cpuset(cpusetid_t *setid); } + SYS_CPUSET_SETID = 485 // { int cpuset_setid(cpuwhich_t which, id_t id, cpusetid_t setid); } + SYS_CPUSET_GETID = 486 // { int cpuset_getid(cpulevel_t level, cpuwhich_t which, id_t id, cpusetid_t *setid); } + SYS_CPUSET_GETAFFINITY = 487 // { int cpuset_getaffinity(cpulevel_t level, cpuwhich_t which, id_t id, size_t cpusetsize, cpuset_t *mask); } + SYS_CPUSET_SETAFFINITY = 488 // { int cpuset_setaffinity(cpulevel_t level, cpuwhich_t which, id_t id, size_t cpusetsize, const cpuset_t *mask); } + SYS_FACCESSAT = 489 // { int faccessat(int fd, char *path, int amode, int flag); } + SYS_FCHMODAT = 490 // { int fchmodat(int fd, char *path, mode_t mode, int flag); } + SYS_FCHOWNAT = 491 // { int fchownat(int fd, char *path, uid_t uid, gid_t gid, int flag); } + SYS_FEXECVE = 492 // { int fexecve(int fd, char **argv, char **envv); } + SYS_FUTIMESAT = 494 // { int futimesat(int fd, char *path, struct timeval *times); } + SYS_LINKAT = 495 // { int linkat(int fd1, char *path1, int fd2, char *path2, int flag); } + SYS_MKDIRAT = 496 // { int mkdirat(int fd, char *path, mode_t mode); } + SYS_MKFIFOAT = 497 // { int mkfifoat(int fd, char *path, mode_t mode); } + SYS_OPENAT = 499 // { int openat(int fd, char *path, int flag, mode_t mode); } + SYS_READLINKAT = 500 // { ssize_t readlinkat(int fd, char *path, char *buf, size_t bufsize); } + SYS_RENAMEAT = 501 // { int renameat(int oldfd, char *old, int newfd, char *new); } + SYS_SYMLINKAT = 502 // { int symlinkat(char *path1, int fd, char *path2); } + SYS_UNLINKAT = 503 // { int unlinkat(int fd, char *path, int flag); } + SYS_POSIX_OPENPT = 504 // { int posix_openpt(int flags); } + SYS_GSSD_SYSCALL = 505 // { int gssd_syscall(char *path); } + SYS_JAIL_GET = 506 // { int jail_get(struct iovec *iovp, unsigned int iovcnt, int flags); } + SYS_JAIL_SET = 507 // { int jail_set(struct iovec *iovp, unsigned int iovcnt, int flags); } + SYS_JAIL_REMOVE = 508 // { int jail_remove(int jid); } + SYS_CLOSEFROM = 509 // { int closefrom(int lowfd); } + SYS___SEMCTL = 510 // { int __semctl(int semid, int semnum, int cmd, union semun *arg); } + SYS_MSGCTL = 511 // { int msgctl(int msqid, int cmd, struct msqid_ds *buf); } + SYS_SHMCTL = 512 // { int shmctl(int shmid, int cmd, struct shmid_ds *buf); } + SYS_LPATHCONF = 513 // { int lpathconf(char *path, int name); } + SYS___CAP_RIGHTS_GET = 515 // { int __cap_rights_get(int version, int fd, cap_rights_t *rightsp); } + SYS_CAP_ENTER = 516 // { int cap_enter(void); } + SYS_CAP_GETMODE = 517 // { int cap_getmode(u_int *modep); } + SYS_PDFORK = 518 // { int pdfork(int *fdp, int flags); } + SYS_PDKILL = 519 // { int pdkill(int fd, int signum); } + SYS_PDGETPID = 520 // { int pdgetpid(int fd, pid_t *pidp); } + SYS_PSELECT = 522 // { int pselect(int nd, fd_set *in, fd_set *ou, fd_set *ex, const struct timespec *ts, const sigset_t *sm); } + SYS_GETLOGINCLASS = 523 // { int getloginclass(char *namebuf, size_t namelen); } + SYS_SETLOGINCLASS = 524 // { int setloginclass(const char *namebuf); } + SYS_RCTL_GET_RACCT = 525 // { int rctl_get_racct(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); } + SYS_RCTL_GET_RULES = 526 // { int rctl_get_rules(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); } + SYS_RCTL_GET_LIMITS = 527 // { int rctl_get_limits(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); } + SYS_RCTL_ADD_RULE = 528 // { int rctl_add_rule(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); } + SYS_RCTL_REMOVE_RULE = 529 // { int rctl_remove_rule(const void *inbufp, size_t inbuflen, void *outbufp, size_t outbuflen); } + SYS_POSIX_FALLOCATE = 530 // { int posix_fallocate(int fd, off_t offset, off_t len); } + SYS_POSIX_FADVISE = 531 // { int posix_fadvise(int fd, off_t offset, off_t len, int advice); } + SYS_WAIT6 = 532 // { int wait6(idtype_t idtype, id_t id, int *status, int options, struct __wrusage *wrusage, siginfo_t *info); } + SYS_CAP_RIGHTS_LIMIT = 533 // { int cap_rights_limit(int fd, cap_rights_t *rightsp); } + SYS_CAP_IOCTLS_LIMIT = 534 // { int cap_ioctls_limit(int fd, const u_long *cmds, size_t ncmds); } + SYS_CAP_IOCTLS_GET = 535 // { ssize_t cap_ioctls_get(int fd, u_long *cmds, size_t maxcmds); } + SYS_CAP_FCNTLS_LIMIT = 536 // { int cap_fcntls_limit(int fd, uint32_t fcntlrights); } + SYS_CAP_FCNTLS_GET = 537 // { int cap_fcntls_get(int fd, uint32_t *fcntlrightsp); } + SYS_BINDAT = 538 // { int bindat(int fd, int s, caddr_t name, int namelen); } + SYS_CONNECTAT = 539 // { int connectat(int fd, int s, caddr_t name, int namelen); } + SYS_CHFLAGSAT = 540 // { int chflagsat(int fd, const char *path, u_long flags, int atflag); } + SYS_ACCEPT4 = 541 // { int accept4(int s, struct sockaddr * __restrict name, __socklen_t * __restrict anamelen, int flags); } + SYS_PIPE2 = 542 // { int pipe2(int *fildes, int flags); } + SYS_AIO_MLOCK = 543 // { int aio_mlock(struct aiocb *aiocbp); } + SYS_PROCCTL = 544 // { int procctl(idtype_t idtype, id_t id, int com, void *data); } + SYS_PPOLL = 545 // { int ppoll(struct pollfd *fds, u_int nfds, const struct timespec *ts, const sigset_t *set); } + SYS_FUTIMENS = 546 // { int futimens(int fd, struct timespec *times); } + SYS_UTIMENSAT = 547 // { int utimensat(int fd, char *path, struct timespec *times, int flag); } + SYS_FDATASYNC = 550 // { int fdatasync(int fd); } + SYS_FSTAT = 551 // { int fstat(int fd, struct stat *sb); } + SYS_FSTATAT = 552 // { int fstatat(int fd, char *path, struct stat *buf, int flag); } + SYS_FHSTAT = 553 // { int fhstat(const struct fhandle *u_fhp, struct stat *sb); } + SYS_GETDIRENTRIES = 554 // { ssize_t getdirentries(int fd, char *buf, size_t count, off_t *basep); } + SYS_STATFS = 555 // { int statfs(char *path, struct statfs *buf); } + SYS_FSTATFS = 556 // { int fstatfs(int fd, struct statfs *buf); } + SYS_GETFSSTAT = 557 // { int getfsstat(struct statfs *buf, long bufsize, int mode); } + SYS_FHSTATFS = 558 // { int fhstatfs(const struct fhandle *u_fhp, struct statfs *buf); } + SYS_MKNODAT = 559 // { int mknodat(int fd, char *path, mode_t mode, dev_t dev); } + SYS_KEVENT = 560 // { int kevent(int fd, struct kevent *changelist, int nchanges, struct kevent *eventlist, int nevents, const struct timespec *timeout); } + SYS_CPUSET_GETDOMAIN = 561 // { int cpuset_getdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int *policy); } + SYS_CPUSET_SETDOMAIN = 562 // { int cpuset_setdomain(cpulevel_t level, cpuwhich_t which, id_t id, size_t domainsetsize, domainset_t *mask, int policy); } + SYS_GETRANDOM = 563 // { int getrandom(void *buf, size_t buflen, unsigned int flags); } + SYS_GETFHAT = 564 // { int getfhat(int fd, char *path, struct fhandle *fhp, int flags); } + SYS_FHLINK = 565 // { int fhlink(struct fhandle *fhp, const char *to); } + SYS_FHLINKAT = 566 // { int fhlinkat(struct fhandle *fhp, int tofd, const char *to,); } + SYS_FHREADLINK = 567 // { int fhreadlink(struct fhandle *fhp, char *buf, size_t bufsize); } + SYS___SYSCTLBYNAME = 570 // { int __sysctlbyname(const char *name, size_t namelen, void *old, size_t *oldlenp, void *new, size_t newlen); } + SYS_CLOSE_RANGE = 575 // { int close_range(u_int lowfd, u_int highfd, int flags); } +) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index 31847d23..62192e1d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -445,4 +445,6 @@ const ( SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 3503cbbd..490aab5d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -367,4 +367,6 @@ const ( SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index 5ecd24bf..aca17b6f 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -409,4 +409,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index 7e5c94cc..54b4dfa5 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -312,4 +312,6 @@ const ( SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go new file mode 100644 index 00000000..44a764c9 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -0,0 +1,311 @@ +// go run linux/mksysnum.go -Wall -Werror -static -I/tmp/include /tmp/include/asm/unistd.h +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build loong64 && linux +// +build loong64,linux + +package unix + +const ( + SYS_IO_SETUP = 0 + SYS_IO_DESTROY = 1 + SYS_IO_SUBMIT = 2 + SYS_IO_CANCEL = 3 + SYS_IO_GETEVENTS = 4 + SYS_SETXATTR = 5 + SYS_LSETXATTR = 6 + SYS_FSETXATTR = 7 + SYS_GETXATTR = 8 + SYS_LGETXATTR = 9 + SYS_FGETXATTR = 10 + SYS_LISTXATTR = 11 + SYS_LLISTXATTR = 12 + SYS_FLISTXATTR = 13 + SYS_REMOVEXATTR = 14 + SYS_LREMOVEXATTR = 15 + SYS_FREMOVEXATTR = 16 + SYS_GETCWD = 17 + SYS_LOOKUP_DCOOKIE = 18 + SYS_EVENTFD2 = 19 + SYS_EPOLL_CREATE1 = 20 + SYS_EPOLL_CTL = 21 + SYS_EPOLL_PWAIT = 22 + SYS_DUP = 23 + SYS_DUP3 = 24 + SYS_FCNTL = 25 + SYS_INOTIFY_INIT1 = 26 + SYS_INOTIFY_ADD_WATCH = 27 + SYS_INOTIFY_RM_WATCH = 28 + SYS_IOCTL = 29 + SYS_IOPRIO_SET = 30 + SYS_IOPRIO_GET = 31 + SYS_FLOCK = 32 + SYS_MKNODAT = 33 + SYS_MKDIRAT = 34 + SYS_UNLINKAT = 35 + SYS_SYMLINKAT = 36 + SYS_LINKAT = 37 + SYS_UMOUNT2 = 39 + SYS_MOUNT = 40 + SYS_PIVOT_ROOT = 41 + SYS_NFSSERVCTL = 42 + SYS_STATFS = 43 + SYS_FSTATFS = 44 + SYS_TRUNCATE = 45 + SYS_FTRUNCATE = 46 + SYS_FALLOCATE = 47 + SYS_FACCESSAT = 48 + SYS_CHDIR = 49 + SYS_FCHDIR = 50 + SYS_CHROOT = 51 + SYS_FCHMOD = 52 + SYS_FCHMODAT = 53 + SYS_FCHOWNAT = 54 + SYS_FCHOWN = 55 + SYS_OPENAT = 56 + SYS_CLOSE = 57 + SYS_VHANGUP = 58 + SYS_PIPE2 = 59 + SYS_QUOTACTL = 60 + SYS_GETDENTS64 = 61 + SYS_LSEEK = 62 + SYS_READ = 63 + SYS_WRITE = 64 + SYS_READV = 65 + SYS_WRITEV = 66 + SYS_PREAD64 = 67 + SYS_PWRITE64 = 68 + SYS_PREADV = 69 + SYS_PWRITEV = 70 + SYS_SENDFILE = 71 + SYS_PSELECT6 = 72 + SYS_PPOLL = 73 + SYS_SIGNALFD4 = 74 + SYS_VMSPLICE = 75 + SYS_SPLICE = 76 + SYS_TEE = 77 + SYS_READLINKAT = 78 + SYS_SYNC = 81 + SYS_FSYNC = 82 + SYS_FDATASYNC = 83 + SYS_SYNC_FILE_RANGE = 84 + SYS_TIMERFD_CREATE = 85 + SYS_TIMERFD_SETTIME = 86 + SYS_TIMERFD_GETTIME = 87 + SYS_UTIMENSAT = 88 + SYS_ACCT = 89 + SYS_CAPGET = 90 + SYS_CAPSET = 91 + SYS_PERSONALITY = 92 + SYS_EXIT = 93 + SYS_EXIT_GROUP = 94 + SYS_WAITID = 95 + SYS_SET_TID_ADDRESS = 96 + SYS_UNSHARE = 97 + SYS_FUTEX = 98 + SYS_SET_ROBUST_LIST = 99 + SYS_GET_ROBUST_LIST = 100 + SYS_NANOSLEEP = 101 + SYS_GETITIMER = 102 + SYS_SETITIMER = 103 + SYS_KEXEC_LOAD = 104 + SYS_INIT_MODULE = 105 + SYS_DELETE_MODULE = 106 + SYS_TIMER_CREATE = 107 + SYS_TIMER_GETTIME = 108 + SYS_TIMER_GETOVERRUN = 109 + SYS_TIMER_SETTIME = 110 + SYS_TIMER_DELETE = 111 + SYS_CLOCK_SETTIME = 112 + SYS_CLOCK_GETTIME = 113 + SYS_CLOCK_GETRES = 114 + SYS_CLOCK_NANOSLEEP = 115 + SYS_SYSLOG = 116 + SYS_PTRACE = 117 + SYS_SCHED_SETPARAM = 118 + SYS_SCHED_SETSCHEDULER = 119 + SYS_SCHED_GETSCHEDULER = 120 + SYS_SCHED_GETPARAM = 121 + SYS_SCHED_SETAFFINITY = 122 + SYS_SCHED_GETAFFINITY = 123 + SYS_SCHED_YIELD = 124 + SYS_SCHED_GET_PRIORITY_MAX = 125 + SYS_SCHED_GET_PRIORITY_MIN = 126 + SYS_SCHED_RR_GET_INTERVAL = 127 + SYS_RESTART_SYSCALL = 128 + SYS_KILL = 129 + SYS_TKILL = 130 + SYS_TGKILL = 131 + SYS_SIGALTSTACK = 132 + SYS_RT_SIGSUSPEND = 133 + SYS_RT_SIGACTION = 134 + SYS_RT_SIGPROCMASK = 135 + SYS_RT_SIGPENDING = 136 + SYS_RT_SIGTIMEDWAIT = 137 + SYS_RT_SIGQUEUEINFO = 138 + SYS_RT_SIGRETURN = 139 + SYS_SETPRIORITY = 140 + SYS_GETPRIORITY = 141 + SYS_REBOOT = 142 + SYS_SETREGID = 143 + SYS_SETGID = 144 + SYS_SETREUID = 145 + SYS_SETUID = 146 + SYS_SETRESUID = 147 + SYS_GETRESUID = 148 + SYS_SETRESGID = 149 + SYS_GETRESGID = 150 + SYS_SETFSUID = 151 + SYS_SETFSGID = 152 + SYS_TIMES = 153 + SYS_SETPGID = 154 + SYS_GETPGID = 155 + SYS_GETSID = 156 + SYS_SETSID = 157 + SYS_GETGROUPS = 158 + SYS_SETGROUPS = 159 + SYS_UNAME = 160 + SYS_SETHOSTNAME = 161 + SYS_SETDOMAINNAME = 162 + SYS_GETRUSAGE = 165 + SYS_UMASK = 166 + SYS_PRCTL = 167 + SYS_GETCPU = 168 + SYS_GETTIMEOFDAY = 169 + SYS_SETTIMEOFDAY = 170 + SYS_ADJTIMEX = 171 + SYS_GETPID = 172 + SYS_GETPPID = 173 + SYS_GETUID = 174 + SYS_GETEUID = 175 + SYS_GETGID = 176 + SYS_GETEGID = 177 + SYS_GETTID = 178 + SYS_SYSINFO = 179 + SYS_MQ_OPEN = 180 + SYS_MQ_UNLINK = 181 + SYS_MQ_TIMEDSEND = 182 + SYS_MQ_TIMEDRECEIVE = 183 + SYS_MQ_NOTIFY = 184 + SYS_MQ_GETSETATTR = 185 + SYS_MSGGET = 186 + SYS_MSGCTL = 187 + SYS_MSGRCV = 188 + SYS_MSGSND = 189 + SYS_SEMGET = 190 + SYS_SEMCTL = 191 + SYS_SEMTIMEDOP = 192 + SYS_SEMOP = 193 + SYS_SHMGET = 194 + SYS_SHMCTL = 195 + SYS_SHMAT = 196 + SYS_SHMDT = 197 + SYS_SOCKET = 198 + SYS_SOCKETPAIR = 199 + SYS_BIND = 200 + SYS_LISTEN = 201 + SYS_ACCEPT = 202 + SYS_CONNECT = 203 + SYS_GETSOCKNAME = 204 + SYS_GETPEERNAME = 205 + SYS_SENDTO = 206 + SYS_RECVFROM = 207 + SYS_SETSOCKOPT = 208 + SYS_GETSOCKOPT = 209 + SYS_SHUTDOWN = 210 + SYS_SENDMSG = 211 + SYS_RECVMSG = 212 + SYS_READAHEAD = 213 + SYS_BRK = 214 + SYS_MUNMAP = 215 + SYS_MREMAP = 216 + SYS_ADD_KEY = 217 + SYS_REQUEST_KEY = 218 + SYS_KEYCTL = 219 + SYS_CLONE = 220 + SYS_EXECVE = 221 + SYS_MMAP = 222 + SYS_FADVISE64 = 223 + SYS_SWAPON = 224 + SYS_SWAPOFF = 225 + SYS_MPROTECT = 226 + SYS_MSYNC = 227 + SYS_MLOCK = 228 + SYS_MUNLOCK = 229 + SYS_MLOCKALL = 230 + SYS_MUNLOCKALL = 231 + SYS_MINCORE = 232 + SYS_MADVISE = 233 + SYS_REMAP_FILE_PAGES = 234 + SYS_MBIND = 235 + SYS_GET_MEMPOLICY = 236 + SYS_SET_MEMPOLICY = 237 + SYS_MIGRATE_PAGES = 238 + SYS_MOVE_PAGES = 239 + SYS_RT_TGSIGQUEUEINFO = 240 + SYS_PERF_EVENT_OPEN = 241 + SYS_ACCEPT4 = 242 + SYS_RECVMMSG = 243 + SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_WAIT4 = 260 + SYS_PRLIMIT64 = 261 + SYS_FANOTIFY_INIT = 262 + SYS_FANOTIFY_MARK = 263 + SYS_NAME_TO_HANDLE_AT = 264 + SYS_OPEN_BY_HANDLE_AT = 265 + SYS_CLOCK_ADJTIME = 266 + SYS_SYNCFS = 267 + SYS_SETNS = 268 + SYS_SENDMMSG = 269 + SYS_PROCESS_VM_READV = 270 + SYS_PROCESS_VM_WRITEV = 271 + SYS_KCMP = 272 + SYS_FINIT_MODULE = 273 + SYS_SCHED_SETATTR = 274 + SYS_SCHED_GETATTR = 275 + SYS_RENAMEAT2 = 276 + SYS_SECCOMP = 277 + SYS_GETRANDOM = 278 + SYS_MEMFD_CREATE = 279 + SYS_BPF = 280 + SYS_EXECVEAT = 281 + SYS_USERFAULTFD = 282 + SYS_MEMBARRIER = 283 + SYS_MLOCK2 = 284 + SYS_COPY_FILE_RANGE = 285 + SYS_PREADV2 = 286 + SYS_PWRITEV2 = 287 + SYS_PKEY_MPROTECT = 288 + SYS_PKEY_ALLOC = 289 + SYS_PKEY_FREE = 290 + SYS_STATX = 291 + SYS_IO_PGETEVENTS = 292 + SYS_RSEQ = 293 + SYS_KEXEC_FILE_LOAD = 294 + SYS_PIDFD_SEND_SIGNAL = 424 + SYS_IO_URING_SETUP = 425 + SYS_IO_URING_ENTER = 426 + SYS_IO_URING_REGISTER = 427 + SYS_OPEN_TREE = 428 + SYS_MOVE_MOUNT = 429 + SYS_FSOPEN = 430 + SYS_FSCONFIG = 431 + SYS_FSMOUNT = 432 + SYS_FSPICK = 433 + SYS_PIDFD_OPEN = 434 + SYS_CLONE3 = 435 + SYS_CLOSE_RANGE = 436 + SYS_OPENAT2 = 437 + SYS_PIDFD_GETFD = 438 + SYS_FACCESSAT2 = 439 + SYS_PROCESS_MADVISE = 440 + SYS_EPOLL_PWAIT2 = 441 + SYS_MOUNT_SETATTR = 442 + SYS_QUOTACTL_FD = 443 + SYS_LANDLOCK_CREATE_RULESET = 444 + SYS_LANDLOCK_ADD_RULE = 445 + SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 +) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index e1e2a2bf..65a99efc 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -429,4 +429,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 4445 SYS_LANDLOCK_RESTRICT_SELF = 4446 SYS_PROCESS_MRELEASE = 4448 + SYS_FUTEX_WAITV = 4449 + SYS_SET_MEMPOLICY_HOME_NODE = 4450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 7651915a..841c8a66 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -359,4 +359,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 5445 SYS_LANDLOCK_RESTRICT_SELF = 5446 SYS_PROCESS_MRELEASE = 5448 + SYS_FUTEX_WAITV = 5449 + SYS_SET_MEMPOLICY_HOME_NODE = 5450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index a26a2c05..e26a7c76 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -359,4 +359,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 5445 SYS_LANDLOCK_RESTRICT_SELF = 5446 SYS_PROCESS_MRELEASE = 5448 + SYS_FUTEX_WAITV = 5449 + SYS_SET_MEMPOLICY_HOME_NODE = 5450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index fda9a6a9..26447260 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -429,4 +429,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 4445 SYS_LANDLOCK_RESTRICT_SELF = 4446 SYS_PROCESS_MRELEASE = 4448 + SYS_FUTEX_WAITV = 4449 + SYS_SET_MEMPOLICY_HOME_NODE = 4450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index e8496150..26aefc18 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -436,4 +436,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index 5ee0678a..8d4cd9d9 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -408,4 +408,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 29c0f9a3..3b405d1f 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -408,4 +408,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 5c9a9a3b..3a9c96b2 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -309,5 +309,8 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 913f50f9..8ffa6646 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -373,4 +373,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 0de03a72..6a39640e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -387,4 +387,6 @@ const ( SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 SYS_PROCESS_MRELEASE = 448 + SYS_FUTEX_WAITV = 449 + SYS_SET_MEMPOLICY_HOME_NODE = 450 ) diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index 885842c0..e2a64f09 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -366,30 +366,57 @@ type ICMPv6Filter struct { Filt [8]uint32 } +type TCPConnectionInfo struct { + State uint8 + Snd_wscale uint8 + Rcv_wscale uint8 + _ uint8 + Options uint32 + Flags uint32 + Rto uint32 + Maxseg uint32 + Snd_ssthresh uint32 + Snd_cwnd uint32 + Snd_wnd uint32 + Snd_sbbytes uint32 + Rcv_wnd uint32 + Rttcur uint32 + Srtt uint32 + Rttvar uint32 + Txpackets uint64 + Txbytes uint64 + Txretransmitbytes uint64 + Rxpackets uint64 + Rxbytes uint64 + Rxoutoforderbytes uint64 + Txretransmitpackets uint64 +} + const ( - SizeofSockaddrInet4 = 0x10 - SizeofSockaddrInet6 = 0x1c - SizeofSockaddrAny = 0x6c - SizeofSockaddrUnix = 0x6a - SizeofSockaddrDatalink = 0x14 - SizeofSockaddrCtl = 0x20 - SizeofSockaddrVM = 0xc - SizeofXvsockpcb = 0xa8 - SizeofXSocket = 0x64 - SizeofXSockbuf = 0x18 - SizeofXVSockPgen = 0x20 - SizeofXucred = 0x4c - SizeofLinger = 0x8 - SizeofIovec = 0x10 - SizeofIPMreq = 0x8 - SizeofIPMreqn = 0xc - SizeofIPv6Mreq = 0x14 - SizeofMsghdr = 0x30 - SizeofCmsghdr = 0xc - SizeofInet4Pktinfo = 0xc - SizeofInet6Pktinfo = 0x14 - SizeofIPv6MTUInfo = 0x20 - SizeofICMPv6Filter = 0x20 + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x14 + SizeofSockaddrCtl = 0x20 + SizeofSockaddrVM = 0xc + SizeofXvsockpcb = 0xa8 + SizeofXSocket = 0x64 + SizeofXSockbuf = 0x18 + SizeofXVSockPgen = 0x20 + SizeofXucred = 0x4c + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPMreqn = 0xc + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet4Pktinfo = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 + SizeofTCPConnectionInfo = 0x70 ) const ( diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index b23c0233..34aa7752 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -366,30 +366,57 @@ type ICMPv6Filter struct { Filt [8]uint32 } +type TCPConnectionInfo struct { + State uint8 + Snd_wscale uint8 + Rcv_wscale uint8 + _ uint8 + Options uint32 + Flags uint32 + Rto uint32 + Maxseg uint32 + Snd_ssthresh uint32 + Snd_cwnd uint32 + Snd_wnd uint32 + Snd_sbbytes uint32 + Rcv_wnd uint32 + Rttcur uint32 + Srtt uint32 + Rttvar uint32 + Txpackets uint64 + Txbytes uint64 + Txretransmitbytes uint64 + Rxpackets uint64 + Rxbytes uint64 + Rxoutoforderbytes uint64 + Txretransmitpackets uint64 +} + const ( - SizeofSockaddrInet4 = 0x10 - SizeofSockaddrInet6 = 0x1c - SizeofSockaddrAny = 0x6c - SizeofSockaddrUnix = 0x6a - SizeofSockaddrDatalink = 0x14 - SizeofSockaddrCtl = 0x20 - SizeofSockaddrVM = 0xc - SizeofXvsockpcb = 0xa8 - SizeofXSocket = 0x64 - SizeofXSockbuf = 0x18 - SizeofXVSockPgen = 0x20 - SizeofXucred = 0x4c - SizeofLinger = 0x8 - SizeofIovec = 0x10 - SizeofIPMreq = 0x8 - SizeofIPMreqn = 0xc - SizeofIPv6Mreq = 0x14 - SizeofMsghdr = 0x30 - SizeofCmsghdr = 0xc - SizeofInet4Pktinfo = 0xc - SizeofInet6Pktinfo = 0x14 - SizeofIPv6MTUInfo = 0x20 - SizeofICMPv6Filter = 0x20 + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x14 + SizeofSockaddrCtl = 0x20 + SizeofSockaddrVM = 0xc + SizeofXvsockpcb = 0xa8 + SizeofXSocket = 0x64 + SizeofXSockbuf = 0x18 + SizeofXVSockPgen = 0x20 + SizeofXucred = 0x4c + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPMreqn = 0xc + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet4Pktinfo = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 + SizeofTCPConnectionInfo = 0x70 ) const ( diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go index 4eec078e..dea0c9a6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go @@ -90,27 +90,6 @@ type Stat_t struct { Spare [10]uint64 } -type stat_freebsd11_t struct { - Dev uint32 - Ino uint32 - Mode uint16 - Nlink uint16 - Uid uint32 - Gid uint32 - Rdev uint32 - Atim Timespec - Mtim Timespec - Ctim Timespec - Size int64 - Blocks int64 - Blksize int32 - Flags uint32 - Gen uint32 - Lspare int32 - Btim Timespec - _ [8]byte -} - type Statfs_t struct { Version uint32 Type uint32 @@ -136,31 +115,6 @@ type Statfs_t struct { Mntonname [1024]byte } -type statfs_freebsd11_t struct { - Version uint32 - Type uint32 - Flags uint64 - Bsize uint64 - Iosize uint64 - Blocks uint64 - Bfree uint64 - Bavail int64 - Files uint64 - Ffree int64 - Syncwrites uint64 - Asyncwrites uint64 - Syncreads uint64 - Asyncreads uint64 - Spare [10]uint64 - Namemax uint32 - Owner uint32 - Fsid Fsid - Charspare [80]int8 - Fstypename [16]byte - Mntfromname [88]byte - Mntonname [88]byte -} - type Flock_t struct { Start int64 Len int64 @@ -181,14 +135,6 @@ type Dirent struct { Name [256]int8 } -type dirent_freebsd11 struct { - Fileno uint32 - Reclen uint16 - Type uint8 - Namlen uint8 - Name [256]int8 -} - type Fsid struct { Val [2]int32 } @@ -337,41 +283,9 @@ const ( ) const ( - PTRACE_ATTACH = 0xa - PTRACE_CONT = 0x7 - PTRACE_DETACH = 0xb - PTRACE_GETFPREGS = 0x23 - PTRACE_GETFSBASE = 0x47 - PTRACE_GETLWPLIST = 0xf - PTRACE_GETNUMLWPS = 0xe - PTRACE_GETREGS = 0x21 - PTRACE_GETXSTATE = 0x45 - PTRACE_IO = 0xc - PTRACE_KILL = 0x8 - PTRACE_LWPEVENTS = 0x18 - PTRACE_LWPINFO = 0xd - PTRACE_SETFPREGS = 0x24 - PTRACE_SETREGS = 0x22 - PTRACE_SINGLESTEP = 0x9 - PTRACE_TRACEME = 0x0 -) - -const ( - PIOD_READ_D = 0x1 - PIOD_WRITE_D = 0x2 - PIOD_READ_I = 0x3 - PIOD_WRITE_I = 0x4 -) - -const ( - PL_FLAG_BORN = 0x100 - PL_FLAG_EXITED = 0x200 - PL_FLAG_SI = 0x20 -) - -const ( - TRAP_BRKPT = 0x1 - TRAP_TRACE = 0x2 + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 ) type PtraceLwpInfoStruct struct { @@ -432,6 +346,8 @@ type FpReg struct { Pad [64]uint8 } +type FpExtendedPrecision struct{} + type PtraceIoDesc struct { Op int32 Offs *byte @@ -444,8 +360,9 @@ type Kevent_t struct { Filter int16 Flags uint16 Fflags uint32 - Data int32 + Data int64 Udata *byte + Ext [4]uint64 } type FdSet struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go index 7622904a..da0ea0d6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go @@ -86,26 +86,6 @@ type Stat_t struct { Spare [10]uint64 } -type stat_freebsd11_t struct { - Dev uint32 - Ino uint32 - Mode uint16 - Nlink uint16 - Uid uint32 - Gid uint32 - Rdev uint32 - Atim Timespec - Mtim Timespec - Ctim Timespec - Size int64 - Blocks int64 - Blksize int32 - Flags uint32 - Gen uint32 - Lspare int32 - Btim Timespec -} - type Statfs_t struct { Version uint32 Type uint32 @@ -131,31 +111,6 @@ type Statfs_t struct { Mntonname [1024]byte } -type statfs_freebsd11_t struct { - Version uint32 - Type uint32 - Flags uint64 - Bsize uint64 - Iosize uint64 - Blocks uint64 - Bfree uint64 - Bavail int64 - Files uint64 - Ffree int64 - Syncwrites uint64 - Asyncwrites uint64 - Syncreads uint64 - Asyncreads uint64 - Spare [10]uint64 - Namemax uint32 - Owner uint32 - Fsid Fsid - Charspare [80]int8 - Fstypename [16]byte - Mntfromname [88]byte - Mntonname [88]byte -} - type Flock_t struct { Start int64 Len int64 @@ -177,14 +132,6 @@ type Dirent struct { Name [256]int8 } -type dirent_freebsd11 struct { - Fileno uint32 - Reclen uint16 - Type uint8 - Namlen uint8 - Name [256]int8 -} - type Fsid struct { Val [2]int32 } @@ -333,41 +280,9 @@ const ( ) const ( - PTRACE_ATTACH = 0xa - PTRACE_CONT = 0x7 - PTRACE_DETACH = 0xb - PTRACE_GETFPREGS = 0x23 - PTRACE_GETFSBASE = 0x47 - PTRACE_GETLWPLIST = 0xf - PTRACE_GETNUMLWPS = 0xe - PTRACE_GETREGS = 0x21 - PTRACE_GETXSTATE = 0x45 - PTRACE_IO = 0xc - PTRACE_KILL = 0x8 - PTRACE_LWPEVENTS = 0x18 - PTRACE_LWPINFO = 0xd - PTRACE_SETFPREGS = 0x24 - PTRACE_SETREGS = 0x22 - PTRACE_SINGLESTEP = 0x9 - PTRACE_TRACEME = 0x0 -) - -const ( - PIOD_READ_D = 0x1 - PIOD_WRITE_D = 0x2 - PIOD_READ_I = 0x3 - PIOD_WRITE_I = 0x4 -) - -const ( - PL_FLAG_BORN = 0x100 - PL_FLAG_EXITED = 0x200 - PL_FLAG_SI = 0x20 -) - -const ( - TRAP_BRKPT = 0x1 - TRAP_TRACE = 0x2 + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 ) type PtraceLwpInfoStruct struct { @@ -435,6 +350,8 @@ type FpReg struct { Spare [12]uint64 } +type FpExtendedPrecision struct{} + type PtraceIoDesc struct { Op int32 Offs *byte @@ -449,6 +366,7 @@ type Kevent_t struct { Fflags uint32 Data int64 Udata *byte + Ext [4]uint64 } type FdSet struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go index 19223ce8..da8f7404 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go @@ -33,7 +33,7 @@ type Timeval struct { _ [4]byte } -type Time_t int32 +type Time_t int64 type Rusage struct { Utime Timeval @@ -88,26 +88,6 @@ type Stat_t struct { Spare [10]uint64 } -type stat_freebsd11_t struct { - Dev uint32 - Ino uint32 - Mode uint16 - Nlink uint16 - Uid uint32 - Gid uint32 - Rdev uint32 - Atim Timespec - Mtim Timespec - Ctim Timespec - Size int64 - Blocks int64 - Blksize int32 - Flags uint32 - Gen uint32 - Lspare int32 - Btim Timespec -} - type Statfs_t struct { Version uint32 Type uint32 @@ -133,31 +113,6 @@ type Statfs_t struct { Mntonname [1024]byte } -type statfs_freebsd11_t struct { - Version uint32 - Type uint32 - Flags uint64 - Bsize uint64 - Iosize uint64 - Blocks uint64 - Bfree uint64 - Bavail int64 - Files uint64 - Ffree int64 - Syncwrites uint64 - Asyncwrites uint64 - Syncreads uint64 - Asyncreads uint64 - Spare [10]uint64 - Namemax uint32 - Owner uint32 - Fsid Fsid - Charspare [80]int8 - Fstypename [16]byte - Mntfromname [88]byte - Mntonname [88]byte -} - type Flock_t struct { Start int64 Len int64 @@ -179,14 +134,6 @@ type Dirent struct { Name [256]int8 } -type dirent_freebsd11 struct { - Fileno uint32 - Reclen uint16 - Type uint8 - Namlen uint8 - Name [256]int8 -} - type Fsid struct { Val [2]int32 } @@ -335,41 +282,9 @@ const ( ) const ( - PTRACE_ATTACH = 0xa - PTRACE_CONT = 0x7 - PTRACE_DETACH = 0xb - PTRACE_GETFPREGS = 0x23 - PTRACE_GETFSBASE = 0x47 - PTRACE_GETLWPLIST = 0xf - PTRACE_GETNUMLWPS = 0xe - PTRACE_GETREGS = 0x21 - PTRACE_GETXSTATE = 0x45 - PTRACE_IO = 0xc - PTRACE_KILL = 0x8 - PTRACE_LWPEVENTS = 0x18 - PTRACE_LWPINFO = 0xd - PTRACE_SETFPREGS = 0x24 - PTRACE_SETREGS = 0x22 - PTRACE_SINGLESTEP = 0x9 - PTRACE_TRACEME = 0x0 -) - -const ( - PIOD_READ_D = 0x1 - PIOD_WRITE_D = 0x2 - PIOD_READ_I = 0x3 - PIOD_WRITE_I = 0x4 -) - -const ( - PL_FLAG_BORN = 0x100 - PL_FLAG_EXITED = 0x200 - PL_FLAG_SI = 0x20 -) - -const ( - TRAP_BRKPT = 0x1 - TRAP_TRACE = 0x2 + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 ) type PtraceLwpInfoStruct struct { @@ -386,15 +301,15 @@ type PtraceLwpInfoStruct struct { } type __Siginfo struct { - Signo int32 - Errno int32 - Code int32 - Pid int32 - Uid uint32 - Status int32 - Addr *byte - Value [4]byte - X_reason [32]byte + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr *byte + Value [4]byte + _ [32]byte } type Sigset_t struct { @@ -402,16 +317,22 @@ type Sigset_t struct { } type Reg struct { - R [13]uint32 - R_sp uint32 - R_lr uint32 - R_pc uint32 - R_cpsr uint32 + R [13]uint32 + Sp uint32 + Lr uint32 + Pc uint32 + Cpsr uint32 } type FpReg struct { - Fpr_fpsr uint32 - Fpr [8][3]uint32 + Fpsr uint32 + Fpr [8]FpExtendedPrecision +} + +type FpExtendedPrecision struct { + Exponent uint32 + Mantissa_hi uint32 + Mantissa_lo uint32 } type PtraceIoDesc struct { @@ -426,8 +347,11 @@ type Kevent_t struct { Filter int16 Flags uint16 Fflags uint32 - Data int32 + _ [4]byte + Data int64 Udata *byte + _ [4]byte + Ext [4]uint64 } type FdSet struct { @@ -453,7 +377,7 @@ type ifMsghdr struct { Addrs int32 Flags int32 Index uint16 - _ [2]byte + _ uint16 Data ifData } @@ -464,7 +388,6 @@ type IfMsghdr struct { Addrs int32 Flags int32 Index uint16 - _ [2]byte Data IfData } @@ -532,7 +455,7 @@ type IfaMsghdr struct { Addrs int32 Flags int32 Index uint16 - _ [2]byte + _ uint16 Metric int32 } @@ -543,7 +466,7 @@ type IfmaMsghdr struct { Addrs int32 Flags int32 Index uint16 - _ [2]byte + _ uint16 } type IfAnnounceMsghdr struct { @@ -560,7 +483,7 @@ type RtMsghdr struct { Version uint8 Type uint8 Index uint16 - _ [2]byte + _ uint16 Flags int32 Addrs int32 Pid int32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go index 8e3e33f6..d69988e5 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go @@ -86,26 +86,6 @@ type Stat_t struct { Spare [10]uint64 } -type stat_freebsd11_t struct { - Dev uint32 - Ino uint32 - Mode uint16 - Nlink uint16 - Uid uint32 - Gid uint32 - Rdev uint32 - Atim Timespec - Mtim Timespec - Ctim Timespec - Size int64 - Blocks int64 - Blksize int32 - Flags uint32 - Gen uint32 - Lspare int32 - Btim Timespec -} - type Statfs_t struct { Version uint32 Type uint32 @@ -131,31 +111,6 @@ type Statfs_t struct { Mntonname [1024]byte } -type statfs_freebsd11_t struct { - Version uint32 - Type uint32 - Flags uint64 - Bsize uint64 - Iosize uint64 - Blocks uint64 - Bfree uint64 - Bavail int64 - Files uint64 - Ffree int64 - Syncwrites uint64 - Asyncwrites uint64 - Syncreads uint64 - Asyncreads uint64 - Spare [10]uint64 - Namemax uint32 - Owner uint32 - Fsid Fsid - Charspare [80]int8 - Fstypename [16]byte - Mntfromname [88]byte - Mntonname [88]byte -} - type Flock_t struct { Start int64 Len int64 @@ -177,14 +132,6 @@ type Dirent struct { Name [256]int8 } -type dirent_freebsd11 struct { - Fileno uint32 - Reclen uint16 - Type uint8 - Namlen uint8 - Name [256]int8 -} - type Fsid struct { Val [2]int32 } @@ -333,39 +280,9 @@ const ( ) const ( - PTRACE_ATTACH = 0xa - PTRACE_CONT = 0x7 - PTRACE_DETACH = 0xb - PTRACE_GETFPREGS = 0x23 - PTRACE_GETLWPLIST = 0xf - PTRACE_GETNUMLWPS = 0xe - PTRACE_GETREGS = 0x21 - PTRACE_IO = 0xc - PTRACE_KILL = 0x8 - PTRACE_LWPEVENTS = 0x18 - PTRACE_LWPINFO = 0xd - PTRACE_SETFPREGS = 0x24 - PTRACE_SETREGS = 0x22 - PTRACE_SINGLESTEP = 0x9 - PTRACE_TRACEME = 0x0 -) - -const ( - PIOD_READ_D = 0x1 - PIOD_WRITE_D = 0x2 - PIOD_READ_I = 0x3 - PIOD_WRITE_I = 0x4 -) - -const ( - PL_FLAG_BORN = 0x100 - PL_FLAG_EXITED = 0x200 - PL_FLAG_SI = 0x20 -) - -const ( - TRAP_BRKPT = 0x1 - TRAP_TRACE = 0x2 + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 ) type PtraceLwpInfoStruct struct { @@ -413,6 +330,8 @@ type FpReg struct { _ [8]byte } +type FpExtendedPrecision struct{} + type PtraceIoDesc struct { Op int32 Offs *byte @@ -427,6 +346,7 @@ type Kevent_t struct { Fflags uint32 Data int64 Udata *byte + Ext [4]uint64 } type FdSet struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go new file mode 100644 index 00000000..d6fd9e88 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go @@ -0,0 +1,626 @@ +// cgo -godefs -- -fsigned-char types_freebsd.go | go run mkpost.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build riscv64 && freebsd +// +build riscv64,freebsd + +package unix + +const ( + SizeofPtr = 0x8 + SizeofShort = 0x2 + SizeofInt = 0x4 + SizeofLong = 0x8 + SizeofLongLong = 0x8 +) + +type ( + _C_short int16 + _C_int int32 + _C_long int64 + _C_long_long int64 +) + +type Timespec struct { + Sec int64 + Nsec int64 +} + +type Timeval struct { + Sec int64 + Usec int64 +} + +type Time_t int64 + +type Rusage struct { + Utime Timeval + Stime Timeval + Maxrss int64 + Ixrss int64 + Idrss int64 + Isrss int64 + Minflt int64 + Majflt int64 + Nswap int64 + Inblock int64 + Oublock int64 + Msgsnd int64 + Msgrcv int64 + Nsignals int64 + Nvcsw int64 + Nivcsw int64 +} + +type Rlimit struct { + Cur int64 + Max int64 +} + +type _Gid_t uint32 + +const ( + _statfsVersion = 0x20140518 + _dirblksiz = 0x400 +) + +type Stat_t struct { + Dev uint64 + Ino uint64 + Nlink uint64 + Mode uint16 + _0 int16 + Uid uint32 + Gid uint32 + _1 int32 + Rdev uint64 + Atim Timespec + Mtim Timespec + Ctim Timespec + Btim Timespec + Size int64 + Blocks int64 + Blksize int32 + Flags uint32 + Gen uint64 + Spare [10]uint64 +} + +type Statfs_t struct { + Version uint32 + Type uint32 + Flags uint64 + Bsize uint64 + Iosize uint64 + Blocks uint64 + Bfree uint64 + Bavail int64 + Files uint64 + Ffree int64 + Syncwrites uint64 + Asyncwrites uint64 + Syncreads uint64 + Asyncreads uint64 + Spare [10]uint64 + Namemax uint32 + Owner uint32 + Fsid Fsid + Charspare [80]int8 + Fstypename [16]byte + Mntfromname [1024]byte + Mntonname [1024]byte +} + +type Flock_t struct { + Start int64 + Len int64 + Pid int32 + Type int16 + Whence int16 + Sysid int32 + _ [4]byte +} + +type Dirent struct { + Fileno uint64 + Off int64 + Reclen uint16 + Type uint8 + Pad0 uint8 + Namlen uint16 + Pad1 uint16 + Name [256]int8 +} + +type Fsid struct { + Val [2]int32 +} + +const ( + PathMax = 0x400 +) + +const ( + FADV_NORMAL = 0x0 + FADV_RANDOM = 0x1 + FADV_SEQUENTIAL = 0x2 + FADV_WILLNEED = 0x3 + FADV_DONTNEED = 0x4 + FADV_NOREUSE = 0x5 +) + +type RawSockaddrInet4 struct { + Len uint8 + Family uint8 + Port uint16 + Addr [4]byte /* in_addr */ + Zero [8]int8 +} + +type RawSockaddrInet6 struct { + Len uint8 + Family uint8 + Port uint16 + Flowinfo uint32 + Addr [16]byte /* in6_addr */ + Scope_id uint32 +} + +type RawSockaddrUnix struct { + Len uint8 + Family uint8 + Path [104]int8 +} + +type RawSockaddrDatalink struct { + Len uint8 + Family uint8 + Index uint16 + Type uint8 + Nlen uint8 + Alen uint8 + Slen uint8 + Data [46]int8 +} + +type RawSockaddr struct { + Len uint8 + Family uint8 + Data [14]int8 +} + +type RawSockaddrAny struct { + Addr RawSockaddr + Pad [92]int8 +} + +type _Socklen uint32 + +type Xucred struct { + Version uint32 + Uid uint32 + Ngroups int16 + Groups [16]uint32 + _ *byte +} + +type Linger struct { + Onoff int32 + Linger int32 +} + +type Iovec struct { + Base *byte + Len uint64 +} + +type IPMreq struct { + Multiaddr [4]byte /* in_addr */ + Interface [4]byte /* in_addr */ +} + +type IPMreqn struct { + Multiaddr [4]byte /* in_addr */ + Address [4]byte /* in_addr */ + Ifindex int32 +} + +type IPv6Mreq struct { + Multiaddr [16]byte /* in6_addr */ + Interface uint32 +} + +type Msghdr struct { + Name *byte + Namelen uint32 + Iov *Iovec + Iovlen int32 + Control *byte + Controllen uint32 + Flags int32 +} + +type Cmsghdr struct { + Len uint32 + Level int32 + Type int32 +} + +type Inet6Pktinfo struct { + Addr [16]byte /* in6_addr */ + Ifindex uint32 +} + +type IPv6MTUInfo struct { + Addr RawSockaddrInet6 + Mtu uint32 +} + +type ICMPv6Filter struct { + Filt [8]uint32 +} + +const ( + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x36 + SizeofXucred = 0x58 + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPMreqn = 0xc + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 +) + +const ( + PTRACE_TRACEME = 0x0 + PTRACE_CONT = 0x7 + PTRACE_KILL = 0x8 +) + +type PtraceLwpInfoStruct struct { + Lwpid int32 + Event int32 + Flags int32 + Sigmask Sigset_t + Siglist Sigset_t + Siginfo __Siginfo + Tdname [20]int8 + Child_pid int32 + Syscall_code uint32 + Syscall_narg uint32 +} + +type __Siginfo struct { + Signo int32 + Errno int32 + Code int32 + Pid int32 + Uid uint32 + Status int32 + Addr *byte + Value [8]byte + _ [40]byte +} + +type Sigset_t struct { + Val [4]uint32 +} + +type Reg struct { + Ra uint64 + Sp uint64 + Gp uint64 + Tp uint64 + T [7]uint64 + S [12]uint64 + A [8]uint64 + Sepc uint64 + Sstatus uint64 +} + +type FpReg struct { + X [32][2]uint64 + Fcsr uint64 +} + +type FpExtendedPrecision struct{} + +type PtraceIoDesc struct { + Op int32 + Offs *byte + Addr *byte + Len uint64 +} + +type Kevent_t struct { + Ident uint64 + Filter int16 + Flags uint16 + Fflags uint32 + Data int64 + Udata *byte + Ext [4]uint64 +} + +type FdSet struct { + Bits [16]uint64 +} + +const ( + sizeofIfMsghdr = 0xa8 + SizeofIfMsghdr = 0xa8 + sizeofIfData = 0x98 + SizeofIfData = 0x98 + SizeofIfaMsghdr = 0x14 + SizeofIfmaMsghdr = 0x10 + SizeofIfAnnounceMsghdr = 0x18 + SizeofRtMsghdr = 0x98 + SizeofRtMetrics = 0x70 +) + +type ifMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Addrs int32 + Flags int32 + Index uint16 + _ uint16 + Data ifData +} + +type IfMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Addrs int32 + Flags int32 + Index uint16 + Data IfData +} + +type ifData struct { + Type uint8 + Physical uint8 + Addrlen uint8 + Hdrlen uint8 + Link_state uint8 + Vhid uint8 + Datalen uint16 + Mtu uint32 + Metric uint32 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Oqdrops uint64 + Noproto uint64 + Hwassist uint64 + _ [8]byte + _ [16]byte +} + +type IfData struct { + Type uint8 + Physical uint8 + Addrlen uint8 + Hdrlen uint8 + Link_state uint8 + Spare_char1 uint8 + Spare_char2 uint8 + Datalen uint8 + Mtu uint64 + Metric uint64 + Baudrate uint64 + Ipackets uint64 + Ierrors uint64 + Opackets uint64 + Oerrors uint64 + Collisions uint64 + Ibytes uint64 + Obytes uint64 + Imcasts uint64 + Omcasts uint64 + Iqdrops uint64 + Noproto uint64 + Hwassist uint64 + Epoch int64 + Lastchange Timeval +} + +type IfaMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Addrs int32 + Flags int32 + Index uint16 + _ uint16 + Metric int32 +} + +type IfmaMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Addrs int32 + Flags int32 + Index uint16 + _ uint16 +} + +type IfAnnounceMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Index uint16 + Name [16]int8 + What uint16 +} + +type RtMsghdr struct { + Msglen uint16 + Version uint8 + Type uint8 + Index uint16 + _ uint16 + Flags int32 + Addrs int32 + Pid int32 + Seq int32 + Errno int32 + Fmask int32 + Inits uint64 + Rmx RtMetrics +} + +type RtMetrics struct { + Locks uint64 + Mtu uint64 + Hopcount uint64 + Expire uint64 + Recvpipe uint64 + Sendpipe uint64 + Ssthresh uint64 + Rtt uint64 + Rttvar uint64 + Pksent uint64 + Weight uint64 + Nhidx uint64 + Filler [2]uint64 +} + +const ( + SizeofBpfVersion = 0x4 + SizeofBpfStat = 0x8 + SizeofBpfZbuf = 0x18 + SizeofBpfProgram = 0x10 + SizeofBpfInsn = 0x8 + SizeofBpfHdr = 0x20 + SizeofBpfZbufHeader = 0x20 +) + +type BpfVersion struct { + Major uint16 + Minor uint16 +} + +type BpfStat struct { + Recv uint32 + Drop uint32 +} + +type BpfZbuf struct { + Bufa *byte + Bufb *byte + Buflen uint64 +} + +type BpfProgram struct { + Len uint32 + Insns *BpfInsn +} + +type BpfInsn struct { + Code uint16 + Jt uint8 + Jf uint8 + K uint32 +} + +type BpfHdr struct { + Tstamp Timeval + Caplen uint32 + Datalen uint32 + Hdrlen uint16 + _ [6]byte +} + +type BpfZbufHeader struct { + Kernel_gen uint32 + Kernel_len uint32 + User_gen uint32 + _ [5]uint32 +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Cc [20]uint8 + Ispeed uint32 + Ospeed uint32 +} + +type Winsize struct { + Row uint16 + Col uint16 + Xpixel uint16 + Ypixel uint16 +} + +const ( + AT_FDCWD = -0x64 + AT_EACCESS = 0x100 + AT_SYMLINK_NOFOLLOW = 0x200 + AT_SYMLINK_FOLLOW = 0x400 + AT_REMOVEDIR = 0x800 +) + +type PollFd struct { + Fd int32 + Events int16 + Revents int16 +} + +const ( + POLLERR = 0x8 + POLLHUP = 0x10 + POLLIN = 0x1 + POLLINIGNEOF = 0x2000 + POLLNVAL = 0x20 + POLLOUT = 0x4 + POLLPRI = 0x2 + POLLRDBAND = 0x80 + POLLRDNORM = 0x40 + POLLWRBAND = 0x100 + POLLWRNORM = 0x4 +) + +type CapRights struct { + Rights [2]uint64 +} + +type Utsname struct { + Sysname [256]byte + Nodename [256]byte + Release [256]byte + Version [256]byte + Machine [256]byte +} + +const SizeofClockinfo = 0x14 + +type Clockinfo struct { + Hz int32 + Tick int32 + Spare int32 + Stathz int32 + Profhz int32 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index f6f0d79c..86984798 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -24,6 +24,11 @@ type ItimerSpec struct { Value Timespec } +type Itimerval struct { + Interval Timeval + Value Timeval +} + const ( TIME_OK = 0x0 TIME_INS = 0x1 @@ -749,6 +754,25 @@ const ( AT_SYMLINK_NOFOLLOW = 0x100 AT_EACCESS = 0x200 + + OPEN_TREE_CLONE = 0x1 + + MOVE_MOUNT_F_SYMLINKS = 0x1 + MOVE_MOUNT_F_AUTOMOUNTS = 0x2 + MOVE_MOUNT_F_EMPTY_PATH = 0x4 + MOVE_MOUNT_T_SYMLINKS = 0x10 + MOVE_MOUNT_T_AUTOMOUNTS = 0x20 + MOVE_MOUNT_T_EMPTY_PATH = 0x40 + MOVE_MOUNT_SET_GROUP = 0x100 + + FSOPEN_CLOEXEC = 0x1 + + FSPICK_CLOEXEC = 0x1 + FSPICK_SYMLINK_NOFOLLOW = 0x2 + FSPICK_NO_AUTOMOUNT = 0x4 + FSPICK_EMPTY_PATH = 0x8 + + FSMOUNT_CLOEXEC = 0x1 ) type OpenHow struct { @@ -1103,7 +1127,9 @@ const ( PERF_BR_SYSRET = 0x8 PERF_BR_COND_CALL = 0x9 PERF_BR_COND_RET = 0xa - PERF_BR_MAX = 0xb + PERF_BR_ERET = 0xb + PERF_BR_IRQ = 0xc + PERF_BR_MAX = 0xd PERF_SAMPLE_REGS_ABI_NONE = 0x0 PERF_SAMPLE_REGS_ABI_32 = 0x1 PERF_SAMPLE_REGS_ABI_64 = 0x2 @@ -1144,7 +1170,8 @@ const ( PERF_RECORD_BPF_EVENT = 0x12 PERF_RECORD_CGROUP = 0x13 PERF_RECORD_TEXT_POKE = 0x14 - PERF_RECORD_MAX = 0x15 + PERF_RECORD_AUX_OUTPUT_HW_ID = 0x15 + PERF_RECORD_MAX = 0x16 PERF_RECORD_KSYMBOL_TYPE_UNKNOWN = 0x0 PERF_RECORD_KSYMBOL_TYPE_BPF = 0x1 PERF_RECORD_KSYMBOL_TYPE_OOL = 0x2 @@ -1784,7 +1811,8 @@ const ( const ( NF_NETDEV_INGRESS = 0x0 - NF_NETDEV_NUMHOOKS = 0x1 + NF_NETDEV_EGRESS = 0x1 + NF_NETDEV_NUMHOOKS = 0x2 ) const ( @@ -2943,7 +2971,7 @@ const ( DEVLINK_CMD_TRAP_POLICER_NEW = 0x47 DEVLINK_CMD_TRAP_POLICER_DEL = 0x48 DEVLINK_CMD_HEALTH_REPORTER_TEST = 0x49 - DEVLINK_CMD_MAX = 0x4d + DEVLINK_CMD_MAX = 0x51 DEVLINK_PORT_TYPE_NOTSET = 0x0 DEVLINK_PORT_TYPE_AUTO = 0x1 DEVLINK_PORT_TYPE_ETH = 0x2 @@ -3166,7 +3194,13 @@ const ( DEVLINK_ATTR_RELOAD_ACTION_INFO = 0xa2 DEVLINK_ATTR_RELOAD_ACTION_STATS = 0xa3 DEVLINK_ATTR_PORT_PCI_SF_NUMBER = 0xa4 - DEVLINK_ATTR_MAX = 0xa9 + DEVLINK_ATTR_RATE_TYPE = 0xa5 + DEVLINK_ATTR_RATE_TX_SHARE = 0xa6 + DEVLINK_ATTR_RATE_TX_MAX = 0xa7 + DEVLINK_ATTR_RATE_NODE_NAME = 0xa8 + DEVLINK_ATTR_RATE_PARENT_NODE_NAME = 0xa9 + DEVLINK_ATTR_REGION_MAX_SNAPSHOTS = 0xaa + DEVLINK_ATTR_MAX = 0xae DEVLINK_DPIPE_FIELD_MAPPING_TYPE_NONE = 0x0 DEVLINK_DPIPE_FIELD_MAPPING_TYPE_IFINDEX = 0x1 DEVLINK_DPIPE_MATCH_TYPE_FIELD_EXACT = 0x0 @@ -3463,7 +3497,14 @@ const ( ETHTOOL_MSG_CABLE_TEST_ACT = 0x1a ETHTOOL_MSG_CABLE_TEST_TDR_ACT = 0x1b ETHTOOL_MSG_TUNNEL_INFO_GET = 0x1c - ETHTOOL_MSG_USER_MAX = 0x21 + ETHTOOL_MSG_FEC_GET = 0x1d + ETHTOOL_MSG_FEC_SET = 0x1e + ETHTOOL_MSG_MODULE_EEPROM_GET = 0x1f + ETHTOOL_MSG_STATS_GET = 0x20 + ETHTOOL_MSG_PHC_VCLOCKS_GET = 0x21 + ETHTOOL_MSG_MODULE_GET = 0x22 + ETHTOOL_MSG_MODULE_SET = 0x23 + ETHTOOL_MSG_USER_MAX = 0x23 ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3494,7 +3535,14 @@ const ( ETHTOOL_MSG_CABLE_TEST_NTF = 0x1b ETHTOOL_MSG_CABLE_TEST_TDR_NTF = 0x1c ETHTOOL_MSG_TUNNEL_INFO_GET_REPLY = 0x1d - ETHTOOL_MSG_KERNEL_MAX = 0x22 + ETHTOOL_MSG_FEC_GET_REPLY = 0x1e + ETHTOOL_MSG_FEC_NTF = 0x1f + ETHTOOL_MSG_MODULE_EEPROM_GET_REPLY = 0x20 + ETHTOOL_MSG_STATS_GET_REPLY = 0x21 + ETHTOOL_MSG_PHC_VCLOCKS_GET_REPLY = 0x22 + ETHTOOL_MSG_MODULE_GET_REPLY = 0x23 + ETHTOOL_MSG_MODULE_NTF = 0x24 + ETHTOOL_MSG_KERNEL_MAX = 0x24 ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3592,7 +3640,11 @@ const ( ETHTOOL_A_RINGS_RX_MINI = 0x7 ETHTOOL_A_RINGS_RX_JUMBO = 0x8 ETHTOOL_A_RINGS_TX = 0x9 - ETHTOOL_A_RINGS_MAX = 0x9 + ETHTOOL_A_RINGS_RX_BUF_LEN = 0xa + ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb + ETHTOOL_A_RINGS_CQE_SIZE = 0xc + ETHTOOL_A_RINGS_TX_PUSH = 0xd + ETHTOOL_A_RINGS_MAX = 0xd ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3744,6 +3796,8 @@ const ( ETHTOOL_A_TUNNEL_INFO_MAX = 0x2 ) +const SPEED_UNKNOWN = -0x1 + type EthtoolDrvinfo struct { Cmd uint32 Driver [32]byte @@ -4043,3 +4097,1505 @@ const ( NL_POLICY_TYPE_ATTR_MASK = 0xc NL_POLICY_TYPE_ATTR_MAX = 0xc ) + +type CANBitTiming struct { + Bitrate uint32 + Sample_point uint32 + Tq uint32 + Prop_seg uint32 + Phase_seg1 uint32 + Phase_seg2 uint32 + Sjw uint32 + Brp uint32 +} + +type CANBitTimingConst struct { + Name [16]uint8 + Tseg1_min uint32 + Tseg1_max uint32 + Tseg2_min uint32 + Tseg2_max uint32 + Sjw_max uint32 + Brp_min uint32 + Brp_max uint32 + Brp_inc uint32 +} + +type CANClock struct { + Freq uint32 +} + +type CANBusErrorCounters struct { + Txerr uint16 + Rxerr uint16 +} + +type CANCtrlMode struct { + Mask uint32 + Flags uint32 +} + +type CANDeviceStats struct { + Bus_error uint32 + Error_warning uint32 + Error_passive uint32 + Bus_off uint32 + Arbitration_lost uint32 + Restarts uint32 +} + +const ( + CAN_STATE_ERROR_ACTIVE = 0x0 + CAN_STATE_ERROR_WARNING = 0x1 + CAN_STATE_ERROR_PASSIVE = 0x2 + CAN_STATE_BUS_OFF = 0x3 + CAN_STATE_STOPPED = 0x4 + CAN_STATE_SLEEPING = 0x5 + CAN_STATE_MAX = 0x6 +) + +const ( + IFLA_CAN_UNSPEC = 0x0 + IFLA_CAN_BITTIMING = 0x1 + IFLA_CAN_BITTIMING_CONST = 0x2 + IFLA_CAN_CLOCK = 0x3 + IFLA_CAN_STATE = 0x4 + IFLA_CAN_CTRLMODE = 0x5 + IFLA_CAN_RESTART_MS = 0x6 + IFLA_CAN_RESTART = 0x7 + IFLA_CAN_BERR_COUNTER = 0x8 + IFLA_CAN_DATA_BITTIMING = 0x9 + IFLA_CAN_DATA_BITTIMING_CONST = 0xa + IFLA_CAN_TERMINATION = 0xb + IFLA_CAN_TERMINATION_CONST = 0xc + IFLA_CAN_BITRATE_CONST = 0xd + IFLA_CAN_DATA_BITRATE_CONST = 0xe + IFLA_CAN_BITRATE_MAX = 0xf +) + +type KCMAttach struct { + Fd int32 + Bpf_fd int32 +} + +type KCMUnattach struct { + Fd int32 +} + +type KCMClone struct { + Fd int32 +} + +const ( + NL80211_AC_BE = 0x2 + NL80211_AC_BK = 0x3 + NL80211_ACL_POLICY_ACCEPT_UNLESS_LISTED = 0x0 + NL80211_ACL_POLICY_DENY_UNLESS_LISTED = 0x1 + NL80211_AC_VI = 0x1 + NL80211_AC_VO = 0x0 + NL80211_ATTR_4ADDR = 0x53 + NL80211_ATTR_ACK = 0x5c + NL80211_ATTR_ACK_SIGNAL = 0x107 + NL80211_ATTR_ACL_POLICY = 0xa5 + NL80211_ATTR_ADMITTED_TIME = 0xd4 + NL80211_ATTR_AIRTIME_WEIGHT = 0x112 + NL80211_ATTR_AKM_SUITES = 0x4c + NL80211_ATTR_AP_ISOLATE = 0x60 + NL80211_ATTR_AUTH_DATA = 0x9c + NL80211_ATTR_AUTH_TYPE = 0x35 + NL80211_ATTR_BANDS = 0xef + NL80211_ATTR_BEACON_HEAD = 0xe + NL80211_ATTR_BEACON_INTERVAL = 0xc + NL80211_ATTR_BEACON_TAIL = 0xf + NL80211_ATTR_BG_SCAN_PERIOD = 0x98 + NL80211_ATTR_BSS_BASIC_RATES = 0x24 + NL80211_ATTR_BSS = 0x2f + NL80211_ATTR_BSS_CTS_PROT = 0x1c + NL80211_ATTR_BSS_HT_OPMODE = 0x6d + NL80211_ATTR_BSSID = 0xf5 + NL80211_ATTR_BSS_SELECT = 0xe3 + NL80211_ATTR_BSS_SHORT_PREAMBLE = 0x1d + NL80211_ATTR_BSS_SHORT_SLOT_TIME = 0x1e + NL80211_ATTR_CENTER_FREQ1 = 0xa0 + NL80211_ATTR_CENTER_FREQ1_OFFSET = 0x123 + NL80211_ATTR_CENTER_FREQ2 = 0xa1 + NL80211_ATTR_CHANNEL_WIDTH = 0x9f + NL80211_ATTR_CH_SWITCH_BLOCK_TX = 0xb8 + NL80211_ATTR_CH_SWITCH_COUNT = 0xb7 + NL80211_ATTR_CIPHER_SUITE_GROUP = 0x4a + NL80211_ATTR_CIPHER_SUITES = 0x39 + NL80211_ATTR_CIPHER_SUITES_PAIRWISE = 0x49 + NL80211_ATTR_CNTDWN_OFFS_BEACON = 0xba + NL80211_ATTR_CNTDWN_OFFS_PRESP = 0xbb + NL80211_ATTR_COALESCE_RULE = 0xb6 + NL80211_ATTR_COALESCE_RULE_CONDITION = 0x2 + NL80211_ATTR_COALESCE_RULE_DELAY = 0x1 + NL80211_ATTR_COALESCE_RULE_MAX = 0x3 + NL80211_ATTR_COALESCE_RULE_PKT_PATTERN = 0x3 + NL80211_ATTR_CONN_FAILED_REASON = 0x9b + NL80211_ATTR_CONTROL_PORT = 0x44 + NL80211_ATTR_CONTROL_PORT_ETHERTYPE = 0x66 + NL80211_ATTR_CONTROL_PORT_NO_ENCRYPT = 0x67 + NL80211_ATTR_CONTROL_PORT_NO_PREAUTH = 0x11e + NL80211_ATTR_CONTROL_PORT_OVER_NL80211 = 0x108 + NL80211_ATTR_COOKIE = 0x58 + NL80211_ATTR_CQM_BEACON_LOSS_EVENT = 0x8 + NL80211_ATTR_CQM = 0x5e + NL80211_ATTR_CQM_MAX = 0x9 + NL80211_ATTR_CQM_PKT_LOSS_EVENT = 0x4 + NL80211_ATTR_CQM_RSSI_HYST = 0x2 + NL80211_ATTR_CQM_RSSI_LEVEL = 0x9 + NL80211_ATTR_CQM_RSSI_THOLD = 0x1 + NL80211_ATTR_CQM_RSSI_THRESHOLD_EVENT = 0x3 + NL80211_ATTR_CQM_TXE_INTVL = 0x7 + NL80211_ATTR_CQM_TXE_PKTS = 0x6 + NL80211_ATTR_CQM_TXE_RATE = 0x5 + NL80211_ATTR_CRIT_PROT_ID = 0xb3 + NL80211_ATTR_CSA_C_OFF_BEACON = 0xba + NL80211_ATTR_CSA_C_OFF_PRESP = 0xbb + NL80211_ATTR_CSA_C_OFFSETS_TX = 0xcd + NL80211_ATTR_CSA_IES = 0xb9 + NL80211_ATTR_DEVICE_AP_SME = 0x8d + NL80211_ATTR_DFS_CAC_TIME = 0x7 + NL80211_ATTR_DFS_REGION = 0x92 + NL80211_ATTR_DISABLE_HE = 0x12d + NL80211_ATTR_DISABLE_HT = 0x93 + NL80211_ATTR_DISABLE_VHT = 0xaf + NL80211_ATTR_DISCONNECTED_BY_AP = 0x47 + NL80211_ATTR_DONT_WAIT_FOR_ACK = 0x8e + NL80211_ATTR_DTIM_PERIOD = 0xd + NL80211_ATTR_DURATION = 0x57 + NL80211_ATTR_EXT_CAPA = 0xa9 + NL80211_ATTR_EXT_CAPA_MASK = 0xaa + NL80211_ATTR_EXTERNAL_AUTH_ACTION = 0x104 + NL80211_ATTR_EXTERNAL_AUTH_SUPPORT = 0x105 + NL80211_ATTR_EXT_FEATURES = 0xd9 + NL80211_ATTR_FEATURE_FLAGS = 0x8f + NL80211_ATTR_FILS_CACHE_ID = 0xfd + NL80211_ATTR_FILS_DISCOVERY = 0x126 + NL80211_ATTR_FILS_ERP_NEXT_SEQ_NUM = 0xfb + NL80211_ATTR_FILS_ERP_REALM = 0xfa + NL80211_ATTR_FILS_ERP_RRK = 0xfc + NL80211_ATTR_FILS_ERP_USERNAME = 0xf9 + NL80211_ATTR_FILS_KEK = 0xf2 + NL80211_ATTR_FILS_NONCES = 0xf3 + NL80211_ATTR_FRAME = 0x33 + NL80211_ATTR_FRAME_MATCH = 0x5b + NL80211_ATTR_FRAME_TYPE = 0x65 + NL80211_ATTR_FREQ_AFTER = 0x3b + NL80211_ATTR_FREQ_BEFORE = 0x3a + NL80211_ATTR_FREQ_FIXED = 0x3c + NL80211_ATTR_FREQ_RANGE_END = 0x3 + NL80211_ATTR_FREQ_RANGE_MAX_BW = 0x4 + NL80211_ATTR_FREQ_RANGE_START = 0x2 + NL80211_ATTR_FTM_RESPONDER = 0x10e + NL80211_ATTR_FTM_RESPONDER_STATS = 0x10f + NL80211_ATTR_GENERATION = 0x2e + NL80211_ATTR_HANDLE_DFS = 0xbf + NL80211_ATTR_HE_6GHZ_CAPABILITY = 0x125 + NL80211_ATTR_HE_BSS_COLOR = 0x11b + NL80211_ATTR_HE_CAPABILITY = 0x10d + NL80211_ATTR_HE_OBSS_PD = 0x117 + NL80211_ATTR_HIDDEN_SSID = 0x7e + NL80211_ATTR_HT_CAPABILITY = 0x1f + NL80211_ATTR_HT_CAPABILITY_MASK = 0x94 + NL80211_ATTR_IE_ASSOC_RESP = 0x80 + NL80211_ATTR_IE = 0x2a + NL80211_ATTR_IE_PROBE_RESP = 0x7f + NL80211_ATTR_IE_RIC = 0xb2 + NL80211_ATTR_IFACE_SOCKET_OWNER = 0xcc + NL80211_ATTR_IFINDEX = 0x3 + NL80211_ATTR_IFNAME = 0x4 + NL80211_ATTR_IFTYPE_AKM_SUITES = 0x11c + NL80211_ATTR_IFTYPE = 0x5 + NL80211_ATTR_IFTYPE_EXT_CAPA = 0xe6 + NL80211_ATTR_INACTIVITY_TIMEOUT = 0x96 + NL80211_ATTR_INTERFACE_COMBINATIONS = 0x78 + NL80211_ATTR_KEY_CIPHER = 0x9 + NL80211_ATTR_KEY = 0x50 + NL80211_ATTR_KEY_DATA = 0x7 + NL80211_ATTR_KEY_DEFAULT = 0xb + NL80211_ATTR_KEY_DEFAULT_MGMT = 0x28 + NL80211_ATTR_KEY_DEFAULT_TYPES = 0x6e + NL80211_ATTR_KEY_IDX = 0x8 + NL80211_ATTR_KEYS = 0x51 + NL80211_ATTR_KEY_SEQ = 0xa + NL80211_ATTR_KEY_TYPE = 0x37 + NL80211_ATTR_LOCAL_MESH_POWER_MODE = 0xa4 + NL80211_ATTR_LOCAL_STATE_CHANGE = 0x5f + NL80211_ATTR_MAC_ACL_MAX = 0xa7 + NL80211_ATTR_MAC_ADDRS = 0xa6 + NL80211_ATTR_MAC = 0x6 + NL80211_ATTR_MAC_HINT = 0xc8 + NL80211_ATTR_MAC_MASK = 0xd7 + NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca + NL80211_ATTR_MAX = 0x137 + NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 + NL80211_ATTR_MAX_CSA_COUNTERS = 0xce + NL80211_ATTR_MAX_MATCH_SETS = 0x85 + NL80211_ATTR_MAX_NUM_PMKIDS = 0x56 + NL80211_ATTR_MAX_NUM_SCAN_SSIDS = 0x2b + NL80211_ATTR_MAX_NUM_SCHED_SCAN_PLANS = 0xde + NL80211_ATTR_MAX_NUM_SCHED_SCAN_SSIDS = 0x7b + NL80211_ATTR_MAX_REMAIN_ON_CHANNEL_DURATION = 0x6f + NL80211_ATTR_MAX_SCAN_IE_LEN = 0x38 + NL80211_ATTR_MAX_SCAN_PLAN_INTERVAL = 0xdf + NL80211_ATTR_MAX_SCAN_PLAN_ITERATIONS = 0xe0 + NL80211_ATTR_MAX_SCHED_SCAN_IE_LEN = 0x7c + NL80211_ATTR_MCAST_RATE = 0x6b + NL80211_ATTR_MDID = 0xb1 + NL80211_ATTR_MEASUREMENT_DURATION = 0xeb + NL80211_ATTR_MEASUREMENT_DURATION_MANDATORY = 0xec + NL80211_ATTR_MESH_CONFIG = 0x23 + NL80211_ATTR_MESH_ID = 0x18 + NL80211_ATTR_MESH_PEER_AID = 0xed + NL80211_ATTR_MESH_SETUP = 0x70 + NL80211_ATTR_MGMT_SUBTYPE = 0x29 + NL80211_ATTR_MNTR_FLAGS = 0x17 + NL80211_ATTR_MPATH_INFO = 0x1b + NL80211_ATTR_MPATH_NEXT_HOP = 0x1a + NL80211_ATTR_MULTICAST_TO_UNICAST_ENABLED = 0xf4 + NL80211_ATTR_MU_MIMO_FOLLOW_MAC_ADDR = 0xe8 + NL80211_ATTR_MU_MIMO_GROUP_DATA = 0xe7 + NL80211_ATTR_NAN_FUNC = 0xf0 + NL80211_ATTR_NAN_MASTER_PREF = 0xee + NL80211_ATTR_NAN_MATCH = 0xf1 + NL80211_ATTR_NETNS_FD = 0xdb + NL80211_ATTR_NOACK_MAP = 0x95 + NL80211_ATTR_NSS = 0x106 + NL80211_ATTR_OFFCHANNEL_TX_OK = 0x6c + NL80211_ATTR_OPER_CLASS = 0xd6 + NL80211_ATTR_OPMODE_NOTIF = 0xc2 + NL80211_ATTR_P2P_CTWINDOW = 0xa2 + NL80211_ATTR_P2P_OPPPS = 0xa3 + NL80211_ATTR_PAD = 0xe5 + NL80211_ATTR_PBSS = 0xe2 + NL80211_ATTR_PEER_AID = 0xb5 + NL80211_ATTR_PEER_MEASUREMENTS = 0x111 + NL80211_ATTR_PID = 0x52 + NL80211_ATTR_PMK = 0xfe + NL80211_ATTR_PMKID = 0x55 + NL80211_ATTR_PMK_LIFETIME = 0x11f + NL80211_ATTR_PMKR0_NAME = 0x102 + NL80211_ATTR_PMK_REAUTH_THRESHOLD = 0x120 + NL80211_ATTR_PMKSA_CANDIDATE = 0x86 + NL80211_ATTR_PORT_AUTHORIZED = 0x103 + NL80211_ATTR_POWER_RULE_MAX_ANT_GAIN = 0x5 + NL80211_ATTR_POWER_RULE_MAX_EIRP = 0x6 + NL80211_ATTR_PREV_BSSID = 0x4f + NL80211_ATTR_PRIVACY = 0x46 + NL80211_ATTR_PROBE_RESP = 0x91 + NL80211_ATTR_PROBE_RESP_OFFLOAD = 0x90 + NL80211_ATTR_PROTOCOL_FEATURES = 0xad + NL80211_ATTR_PS_STATE = 0x5d + NL80211_ATTR_QOS_MAP = 0xc7 + NL80211_ATTR_RADAR_EVENT = 0xa8 + NL80211_ATTR_REASON_CODE = 0x36 + NL80211_ATTR_RECEIVE_MULTICAST = 0x121 + NL80211_ATTR_RECONNECT_REQUESTED = 0x12b + NL80211_ATTR_REG_ALPHA2 = 0x21 + NL80211_ATTR_REG_INDOOR = 0xdd + NL80211_ATTR_REG_INITIATOR = 0x30 + NL80211_ATTR_REG_RULE_FLAGS = 0x1 + NL80211_ATTR_REG_RULES = 0x22 + NL80211_ATTR_REG_TYPE = 0x31 + NL80211_ATTR_REKEY_DATA = 0x7a + NL80211_ATTR_REQ_IE = 0x4d + NL80211_ATTR_RESP_IE = 0x4e + NL80211_ATTR_ROAM_SUPPORT = 0x83 + NL80211_ATTR_RX_FRAME_TYPES = 0x64 + NL80211_ATTR_RXMGMT_FLAGS = 0xbc + NL80211_ATTR_RX_SIGNAL_DBM = 0x97 + NL80211_ATTR_S1G_CAPABILITY = 0x128 + NL80211_ATTR_S1G_CAPABILITY_MASK = 0x129 + NL80211_ATTR_SAE_DATA = 0x9c + NL80211_ATTR_SAE_PASSWORD = 0x115 + NL80211_ATTR_SAE_PWE = 0x12a + NL80211_ATTR_SAR_SPEC = 0x12c + NL80211_ATTR_SCAN_FLAGS = 0x9e + NL80211_ATTR_SCAN_FREQ_KHZ = 0x124 + NL80211_ATTR_SCAN_FREQUENCIES = 0x2c + NL80211_ATTR_SCAN_GENERATION = 0x2e + NL80211_ATTR_SCAN_SSIDS = 0x2d + NL80211_ATTR_SCAN_START_TIME_TSF_BSSID = 0xea + NL80211_ATTR_SCAN_START_TIME_TSF = 0xe9 + NL80211_ATTR_SCAN_SUPP_RATES = 0x7d + NL80211_ATTR_SCHED_SCAN_DELAY = 0xdc + NL80211_ATTR_SCHED_SCAN_INTERVAL = 0x77 + NL80211_ATTR_SCHED_SCAN_MATCH = 0x84 + NL80211_ATTR_SCHED_SCAN_MATCH_SSID = 0x1 + NL80211_ATTR_SCHED_SCAN_MAX_REQS = 0x100 + NL80211_ATTR_SCHED_SCAN_MULTI = 0xff + NL80211_ATTR_SCHED_SCAN_PLANS = 0xe1 + NL80211_ATTR_SCHED_SCAN_RELATIVE_RSSI = 0xf6 + NL80211_ATTR_SCHED_SCAN_RSSI_ADJUST = 0xf7 + NL80211_ATTR_SMPS_MODE = 0xd5 + NL80211_ATTR_SOCKET_OWNER = 0xcc + NL80211_ATTR_SOFTWARE_IFTYPES = 0x79 + NL80211_ATTR_SPLIT_WIPHY_DUMP = 0xae + NL80211_ATTR_SSID = 0x34 + NL80211_ATTR_STA_AID = 0x10 + NL80211_ATTR_STA_CAPABILITY = 0xab + NL80211_ATTR_STA_EXT_CAPABILITY = 0xac + NL80211_ATTR_STA_FLAGS2 = 0x43 + NL80211_ATTR_STA_FLAGS = 0x11 + NL80211_ATTR_STA_INFO = 0x15 + NL80211_ATTR_STA_LISTEN_INTERVAL = 0x12 + NL80211_ATTR_STA_PLINK_ACTION = 0x19 + NL80211_ATTR_STA_PLINK_STATE = 0x74 + NL80211_ATTR_STA_SUPPORTED_CHANNELS = 0xbd + NL80211_ATTR_STA_SUPPORTED_OPER_CLASSES = 0xbe + NL80211_ATTR_STA_SUPPORTED_RATES = 0x13 + NL80211_ATTR_STA_SUPPORT_P2P_PS = 0xe4 + NL80211_ATTR_STATUS_CODE = 0x48 + NL80211_ATTR_STA_TX_POWER = 0x114 + NL80211_ATTR_STA_TX_POWER_SETTING = 0x113 + NL80211_ATTR_STA_VLAN = 0x14 + NL80211_ATTR_STA_WME = 0x81 + NL80211_ATTR_SUPPORT_10_MHZ = 0xc1 + NL80211_ATTR_SUPPORT_5_MHZ = 0xc0 + NL80211_ATTR_SUPPORT_AP_UAPSD = 0x82 + NL80211_ATTR_SUPPORTED_COMMANDS = 0x32 + NL80211_ATTR_SUPPORTED_IFTYPES = 0x20 + NL80211_ATTR_SUPPORT_IBSS_RSN = 0x68 + NL80211_ATTR_SUPPORT_MESH_AUTH = 0x73 + NL80211_ATTR_SURVEY_INFO = 0x54 + NL80211_ATTR_SURVEY_RADIO_STATS = 0xda + NL80211_ATTR_TDLS_ACTION = 0x88 + NL80211_ATTR_TDLS_DIALOG_TOKEN = 0x89 + NL80211_ATTR_TDLS_EXTERNAL_SETUP = 0x8c + NL80211_ATTR_TDLS_INITIATOR = 0xcf + NL80211_ATTR_TDLS_OPERATION = 0x8a + NL80211_ATTR_TDLS_PEER_CAPABILITY = 0xcb + NL80211_ATTR_TDLS_SUPPORT = 0x8b + NL80211_ATTR_TESTDATA = 0x45 + NL80211_ATTR_TID_CONFIG = 0x11d + NL80211_ATTR_TIMED_OUT = 0x41 + NL80211_ATTR_TIMEOUT = 0x110 + NL80211_ATTR_TIMEOUT_REASON = 0xf8 + NL80211_ATTR_TSID = 0xd2 + NL80211_ATTR_TWT_RESPONDER = 0x116 + NL80211_ATTR_TX_FRAME_TYPES = 0x63 + NL80211_ATTR_TX_NO_CCK_RATE = 0x87 + NL80211_ATTR_TXQ_LIMIT = 0x10a + NL80211_ATTR_TXQ_MEMORY_LIMIT = 0x10b + NL80211_ATTR_TXQ_QUANTUM = 0x10c + NL80211_ATTR_TXQ_STATS = 0x109 + NL80211_ATTR_TX_RATES = 0x5a + NL80211_ATTR_UNSOL_BCAST_PROBE_RESP = 0x127 + NL80211_ATTR_UNSPEC = 0x0 + NL80211_ATTR_USE_MFP = 0x42 + NL80211_ATTR_USER_PRIO = 0xd3 + NL80211_ATTR_USER_REG_HINT_TYPE = 0x9a + NL80211_ATTR_USE_RRM = 0xd0 + NL80211_ATTR_VENDOR_DATA = 0xc5 + NL80211_ATTR_VENDOR_EVENTS = 0xc6 + NL80211_ATTR_VENDOR_ID = 0xc3 + NL80211_ATTR_VENDOR_SUBCMD = 0xc4 + NL80211_ATTR_VHT_CAPABILITY = 0x9d + NL80211_ATTR_VHT_CAPABILITY_MASK = 0xb0 + NL80211_ATTR_VLAN_ID = 0x11a + NL80211_ATTR_WANT_1X_4WAY_HS = 0x101 + NL80211_ATTR_WDEV = 0x99 + NL80211_ATTR_WIPHY_ANTENNA_AVAIL_RX = 0x72 + NL80211_ATTR_WIPHY_ANTENNA_AVAIL_TX = 0x71 + NL80211_ATTR_WIPHY_ANTENNA_RX = 0x6a + NL80211_ATTR_WIPHY_ANTENNA_TX = 0x69 + NL80211_ATTR_WIPHY_BANDS = 0x16 + NL80211_ATTR_WIPHY_CHANNEL_TYPE = 0x27 + NL80211_ATTR_WIPHY = 0x1 + NL80211_ATTR_WIPHY_COVERAGE_CLASS = 0x59 + NL80211_ATTR_WIPHY_DYN_ACK = 0xd1 + NL80211_ATTR_WIPHY_EDMG_BW_CONFIG = 0x119 + NL80211_ATTR_WIPHY_EDMG_CHANNELS = 0x118 + NL80211_ATTR_WIPHY_FRAG_THRESHOLD = 0x3f + NL80211_ATTR_WIPHY_FREQ = 0x26 + NL80211_ATTR_WIPHY_FREQ_HINT = 0xc9 + NL80211_ATTR_WIPHY_FREQ_OFFSET = 0x122 + NL80211_ATTR_WIPHY_NAME = 0x2 + NL80211_ATTR_WIPHY_RETRY_LONG = 0x3e + NL80211_ATTR_WIPHY_RETRY_SHORT = 0x3d + NL80211_ATTR_WIPHY_RTS_THRESHOLD = 0x40 + NL80211_ATTR_WIPHY_SELF_MANAGED_REG = 0xd8 + NL80211_ATTR_WIPHY_TX_POWER_LEVEL = 0x62 + NL80211_ATTR_WIPHY_TX_POWER_SETTING = 0x61 + NL80211_ATTR_WIPHY_TXQ_PARAMS = 0x25 + NL80211_ATTR_WOWLAN_TRIGGERS = 0x75 + NL80211_ATTR_WOWLAN_TRIGGERS_SUPPORTED = 0x76 + NL80211_ATTR_WPA_VERSIONS = 0x4b + NL80211_AUTHTYPE_AUTOMATIC = 0x8 + NL80211_AUTHTYPE_FILS_PK = 0x7 + NL80211_AUTHTYPE_FILS_SK = 0x5 + NL80211_AUTHTYPE_FILS_SK_PFS = 0x6 + NL80211_AUTHTYPE_FT = 0x2 + NL80211_AUTHTYPE_MAX = 0x7 + NL80211_AUTHTYPE_NETWORK_EAP = 0x3 + NL80211_AUTHTYPE_OPEN_SYSTEM = 0x0 + NL80211_AUTHTYPE_SAE = 0x4 + NL80211_AUTHTYPE_SHARED_KEY = 0x1 + NL80211_BAND_2GHZ = 0x0 + NL80211_BAND_5GHZ = 0x1 + NL80211_BAND_60GHZ = 0x2 + NL80211_BAND_6GHZ = 0x3 + NL80211_BAND_ATTR_EDMG_BW_CONFIG = 0xb + NL80211_BAND_ATTR_EDMG_CHANNELS = 0xa + NL80211_BAND_ATTR_FREQS = 0x1 + NL80211_BAND_ATTR_HT_AMPDU_DENSITY = 0x6 + NL80211_BAND_ATTR_HT_AMPDU_FACTOR = 0x5 + NL80211_BAND_ATTR_HT_CAPA = 0x4 + NL80211_BAND_ATTR_HT_MCS_SET = 0x3 + NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 + NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_RATES = 0x2 + NL80211_BAND_ATTR_VHT_CAPA = 0x8 + NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 + NL80211_BAND_IFTYPE_ATTR_HE_6GHZ_CAPA = 0x6 + NL80211_BAND_IFTYPE_ATTR_HE_CAP_MAC = 0x2 + NL80211_BAND_IFTYPE_ATTR_HE_CAP_MCS_SET = 0x4 + NL80211_BAND_IFTYPE_ATTR_HE_CAP_PHY = 0x3 + NL80211_BAND_IFTYPE_ATTR_HE_CAP_PPE = 0x5 + NL80211_BAND_IFTYPE_ATTR_IFTYPES = 0x1 + NL80211_BAND_IFTYPE_ATTR_MAX = 0xb + NL80211_BAND_S1GHZ = 0x4 + NL80211_BITRATE_ATTR_2GHZ_SHORTPREAMBLE = 0x2 + NL80211_BITRATE_ATTR_MAX = 0x2 + NL80211_BITRATE_ATTR_RATE = 0x1 + NL80211_BSS_BEACON_IES = 0xb + NL80211_BSS_BEACON_INTERVAL = 0x4 + NL80211_BSS_BEACON_TSF = 0xd + NL80211_BSS_BSSID = 0x1 + NL80211_BSS_CAPABILITY = 0x5 + NL80211_BSS_CHAIN_SIGNAL = 0x13 + NL80211_BSS_CHAN_WIDTH_10 = 0x1 + NL80211_BSS_CHAN_WIDTH_1 = 0x3 + NL80211_BSS_CHAN_WIDTH_20 = 0x0 + NL80211_BSS_CHAN_WIDTH_2 = 0x4 + NL80211_BSS_CHAN_WIDTH_5 = 0x2 + NL80211_BSS_CHAN_WIDTH = 0xc + NL80211_BSS_FREQUENCY = 0x2 + NL80211_BSS_FREQUENCY_OFFSET = 0x14 + NL80211_BSS_INFORMATION_ELEMENTS = 0x6 + NL80211_BSS_LAST_SEEN_BOOTTIME = 0xf + NL80211_BSS_MAX = 0x14 + NL80211_BSS_PAD = 0x10 + NL80211_BSS_PARENT_BSSID = 0x12 + NL80211_BSS_PARENT_TSF = 0x11 + NL80211_BSS_PRESP_DATA = 0xe + NL80211_BSS_SEEN_MS_AGO = 0xa + NL80211_BSS_SELECT_ATTR_BAND_PREF = 0x2 + NL80211_BSS_SELECT_ATTR_MAX = 0x3 + NL80211_BSS_SELECT_ATTR_RSSI_ADJUST = 0x3 + NL80211_BSS_SELECT_ATTR_RSSI = 0x1 + NL80211_BSS_SIGNAL_MBM = 0x7 + NL80211_BSS_SIGNAL_UNSPEC = 0x8 + NL80211_BSS_STATUS_ASSOCIATED = 0x1 + NL80211_BSS_STATUS_AUTHENTICATED = 0x0 + NL80211_BSS_STATUS = 0x9 + NL80211_BSS_STATUS_IBSS_JOINED = 0x2 + NL80211_BSS_TSF = 0x3 + NL80211_CHAN_HT20 = 0x1 + NL80211_CHAN_HT40MINUS = 0x2 + NL80211_CHAN_HT40PLUS = 0x3 + NL80211_CHAN_NO_HT = 0x0 + NL80211_CHAN_WIDTH_10 = 0x7 + NL80211_CHAN_WIDTH_160 = 0x5 + NL80211_CHAN_WIDTH_16 = 0xc + NL80211_CHAN_WIDTH_1 = 0x8 + NL80211_CHAN_WIDTH_20 = 0x1 + NL80211_CHAN_WIDTH_20_NOHT = 0x0 + NL80211_CHAN_WIDTH_2 = 0x9 + NL80211_CHAN_WIDTH_40 = 0x2 + NL80211_CHAN_WIDTH_4 = 0xa + NL80211_CHAN_WIDTH_5 = 0x6 + NL80211_CHAN_WIDTH_80 = 0x3 + NL80211_CHAN_WIDTH_80P80 = 0x4 + NL80211_CHAN_WIDTH_8 = 0xb + NL80211_CMD_ABORT_SCAN = 0x72 + NL80211_CMD_ACTION = 0x3b + NL80211_CMD_ACTION_TX_STATUS = 0x3c + NL80211_CMD_ADD_NAN_FUNCTION = 0x75 + NL80211_CMD_ADD_TX_TS = 0x69 + NL80211_CMD_ASSOCIATE = 0x26 + NL80211_CMD_AUTHENTICATE = 0x25 + NL80211_CMD_CANCEL_REMAIN_ON_CHANNEL = 0x38 + NL80211_CMD_CHANGE_NAN_CONFIG = 0x77 + NL80211_CMD_CHANNEL_SWITCH = 0x66 + NL80211_CMD_CH_SWITCH_NOTIFY = 0x58 + NL80211_CMD_CH_SWITCH_STARTED_NOTIFY = 0x6e + NL80211_CMD_CONNECT = 0x2e + NL80211_CMD_CONN_FAILED = 0x5b + NL80211_CMD_CONTROL_PORT_FRAME = 0x81 + NL80211_CMD_CONTROL_PORT_FRAME_TX_STATUS = 0x8b + NL80211_CMD_CRIT_PROTOCOL_START = 0x62 + NL80211_CMD_CRIT_PROTOCOL_STOP = 0x63 + NL80211_CMD_DEAUTHENTICATE = 0x27 + NL80211_CMD_DEL_BEACON = 0x10 + NL80211_CMD_DEL_INTERFACE = 0x8 + NL80211_CMD_DEL_KEY = 0xc + NL80211_CMD_DEL_MPATH = 0x18 + NL80211_CMD_DEL_NAN_FUNCTION = 0x76 + NL80211_CMD_DEL_PMK = 0x7c + NL80211_CMD_DEL_PMKSA = 0x35 + NL80211_CMD_DEL_STATION = 0x14 + NL80211_CMD_DEL_TX_TS = 0x6a + NL80211_CMD_DEL_WIPHY = 0x4 + NL80211_CMD_DISASSOCIATE = 0x28 + NL80211_CMD_DISCONNECT = 0x30 + NL80211_CMD_EXTERNAL_AUTH = 0x7f + NL80211_CMD_FLUSH_PMKSA = 0x36 + NL80211_CMD_FRAME = 0x3b + NL80211_CMD_FRAME_TX_STATUS = 0x3c + NL80211_CMD_FRAME_WAIT_CANCEL = 0x43 + NL80211_CMD_FT_EVENT = 0x61 + NL80211_CMD_GET_BEACON = 0xd + NL80211_CMD_GET_COALESCE = 0x64 + NL80211_CMD_GET_FTM_RESPONDER_STATS = 0x82 + NL80211_CMD_GET_INTERFACE = 0x5 + NL80211_CMD_GET_KEY = 0x9 + NL80211_CMD_GET_MESH_CONFIG = 0x1c + NL80211_CMD_GET_MESH_PARAMS = 0x1c + NL80211_CMD_GET_MPATH = 0x15 + NL80211_CMD_GET_MPP = 0x6b + NL80211_CMD_GET_POWER_SAVE = 0x3e + NL80211_CMD_GET_PROTOCOL_FEATURES = 0x5f + NL80211_CMD_GET_REG = 0x1f + NL80211_CMD_GET_SCAN = 0x20 + NL80211_CMD_GET_STATION = 0x11 + NL80211_CMD_GET_SURVEY = 0x32 + NL80211_CMD_GET_WIPHY = 0x1 + NL80211_CMD_GET_WOWLAN = 0x49 + NL80211_CMD_JOIN_IBSS = 0x2b + NL80211_CMD_JOIN_MESH = 0x44 + NL80211_CMD_JOIN_OCB = 0x6c + NL80211_CMD_LEAVE_IBSS = 0x2c + NL80211_CMD_LEAVE_MESH = 0x45 + NL80211_CMD_LEAVE_OCB = 0x6d + NL80211_CMD_MAX = 0x93 + NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 + NL80211_CMD_NAN_MATCH = 0x78 + NL80211_CMD_NEW_BEACON = 0xf + NL80211_CMD_NEW_INTERFACE = 0x7 + NL80211_CMD_NEW_KEY = 0xb + NL80211_CMD_NEW_MPATH = 0x17 + NL80211_CMD_NEW_PEER_CANDIDATE = 0x48 + NL80211_CMD_NEW_SCAN_RESULTS = 0x22 + NL80211_CMD_NEW_STATION = 0x13 + NL80211_CMD_NEW_SURVEY_RESULTS = 0x33 + NL80211_CMD_NEW_WIPHY = 0x3 + NL80211_CMD_NOTIFY_CQM = 0x40 + NL80211_CMD_NOTIFY_RADAR = 0x86 + NL80211_CMD_PEER_MEASUREMENT_COMPLETE = 0x85 + NL80211_CMD_PEER_MEASUREMENT_RESULT = 0x84 + NL80211_CMD_PEER_MEASUREMENT_START = 0x83 + NL80211_CMD_PMKSA_CANDIDATE = 0x50 + NL80211_CMD_PORT_AUTHORIZED = 0x7d + NL80211_CMD_PROBE_CLIENT = 0x54 + NL80211_CMD_PROBE_MESH_LINK = 0x88 + NL80211_CMD_RADAR_DETECT = 0x5e + NL80211_CMD_REG_BEACON_HINT = 0x2a + NL80211_CMD_REG_CHANGE = 0x24 + NL80211_CMD_REGISTER_ACTION = 0x3a + NL80211_CMD_REGISTER_BEACONS = 0x55 + NL80211_CMD_REGISTER_FRAME = 0x3a + NL80211_CMD_RELOAD_REGDB = 0x7e + NL80211_CMD_REMAIN_ON_CHANNEL = 0x37 + NL80211_CMD_REQ_SET_REG = 0x1b + NL80211_CMD_ROAM = 0x2f + NL80211_CMD_SCAN_ABORTED = 0x23 + NL80211_CMD_SCHED_SCAN_RESULTS = 0x4d + NL80211_CMD_SCHED_SCAN_STOPPED = 0x4e + NL80211_CMD_SET_BEACON = 0xe + NL80211_CMD_SET_BSS = 0x19 + NL80211_CMD_SET_CHANNEL = 0x41 + NL80211_CMD_SET_COALESCE = 0x65 + NL80211_CMD_SET_CQM = 0x3f + NL80211_CMD_SET_INTERFACE = 0x6 + NL80211_CMD_SET_KEY = 0xa + NL80211_CMD_SET_MAC_ACL = 0x5d + NL80211_CMD_SET_MCAST_RATE = 0x5c + NL80211_CMD_SET_MESH_CONFIG = 0x1d + NL80211_CMD_SET_MESH_PARAMS = 0x1d + NL80211_CMD_SET_MGMT_EXTRA_IE = 0x1e + NL80211_CMD_SET_MPATH = 0x16 + NL80211_CMD_SET_MULTICAST_TO_UNICAST = 0x79 + NL80211_CMD_SET_NOACK_MAP = 0x57 + NL80211_CMD_SET_PMK = 0x7b + NL80211_CMD_SET_PMKSA = 0x34 + NL80211_CMD_SET_POWER_SAVE = 0x3d + NL80211_CMD_SET_QOS_MAP = 0x68 + NL80211_CMD_SET_REG = 0x1a + NL80211_CMD_SET_REKEY_OFFLOAD = 0x4f + NL80211_CMD_SET_SAR_SPECS = 0x8c + NL80211_CMD_SET_STATION = 0x12 + NL80211_CMD_SET_TID_CONFIG = 0x89 + NL80211_CMD_SET_TX_BITRATE_MASK = 0x39 + NL80211_CMD_SET_WDS_PEER = 0x42 + NL80211_CMD_SET_WIPHY = 0x2 + NL80211_CMD_SET_WIPHY_NETNS = 0x31 + NL80211_CMD_SET_WOWLAN = 0x4a + NL80211_CMD_STA_OPMODE_CHANGED = 0x80 + NL80211_CMD_START_AP = 0xf + NL80211_CMD_START_NAN = 0x73 + NL80211_CMD_START_P2P_DEVICE = 0x59 + NL80211_CMD_START_SCHED_SCAN = 0x4b + NL80211_CMD_STOP_AP = 0x10 + NL80211_CMD_STOP_NAN = 0x74 + NL80211_CMD_STOP_P2P_DEVICE = 0x5a + NL80211_CMD_STOP_SCHED_SCAN = 0x4c + NL80211_CMD_TDLS_CANCEL_CHANNEL_SWITCH = 0x70 + NL80211_CMD_TDLS_CHANNEL_SWITCH = 0x6f + NL80211_CMD_TDLS_MGMT = 0x52 + NL80211_CMD_TDLS_OPER = 0x51 + NL80211_CMD_TESTMODE = 0x2d + NL80211_CMD_TRIGGER_SCAN = 0x21 + NL80211_CMD_UNEXPECTED_4ADDR_FRAME = 0x56 + NL80211_CMD_UNEXPECTED_FRAME = 0x53 + NL80211_CMD_UNPROT_BEACON = 0x8a + NL80211_CMD_UNPROT_DEAUTHENTICATE = 0x46 + NL80211_CMD_UNPROT_DISASSOCIATE = 0x47 + NL80211_CMD_UNSPEC = 0x0 + NL80211_CMD_UPDATE_CONNECT_PARAMS = 0x7a + NL80211_CMD_UPDATE_FT_IES = 0x60 + NL80211_CMD_UPDATE_OWE_INFO = 0x87 + NL80211_CMD_VENDOR = 0x67 + NL80211_CMD_WIPHY_REG_CHANGE = 0x71 + NL80211_COALESCE_CONDITION_MATCH = 0x0 + NL80211_COALESCE_CONDITION_NO_MATCH = 0x1 + NL80211_CONN_FAIL_BLOCKED_CLIENT = 0x1 + NL80211_CONN_FAIL_MAX_CLIENTS = 0x0 + NL80211_CQM_RSSI_BEACON_LOSS_EVENT = 0x2 + NL80211_CQM_RSSI_THRESHOLD_EVENT_HIGH = 0x1 + NL80211_CQM_RSSI_THRESHOLD_EVENT_LOW = 0x0 + NL80211_CQM_TXE_MAX_INTVL = 0x708 + NL80211_CRIT_PROTO_APIPA = 0x3 + NL80211_CRIT_PROTO_DHCP = 0x1 + NL80211_CRIT_PROTO_EAPOL = 0x2 + NL80211_CRIT_PROTO_MAX_DURATION = 0x1388 + NL80211_CRIT_PROTO_UNSPEC = 0x0 + NL80211_DFS_AVAILABLE = 0x2 + NL80211_DFS_ETSI = 0x2 + NL80211_DFS_FCC = 0x1 + NL80211_DFS_JP = 0x3 + NL80211_DFS_UNAVAILABLE = 0x1 + NL80211_DFS_UNSET = 0x0 + NL80211_DFS_USABLE = 0x0 + NL80211_EDMG_BW_CONFIG_MAX = 0xf + NL80211_EDMG_BW_CONFIG_MIN = 0x4 + NL80211_EDMG_CHANNELS_MAX = 0x3c + NL80211_EDMG_CHANNELS_MIN = 0x1 + NL80211_EXTERNAL_AUTH_ABORT = 0x1 + NL80211_EXTERNAL_AUTH_START = 0x0 + NL80211_EXT_FEATURE_4WAY_HANDSHAKE_AP_PSK = 0x32 + NL80211_EXT_FEATURE_4WAY_HANDSHAKE_STA_1X = 0x10 + NL80211_EXT_FEATURE_4WAY_HANDSHAKE_STA_PSK = 0xf + NL80211_EXT_FEATURE_ACCEPT_BCAST_PROBE_RESP = 0x12 + NL80211_EXT_FEATURE_ACK_SIGNAL_SUPPORT = 0x1b + NL80211_EXT_FEATURE_AIRTIME_FAIRNESS = 0x21 + NL80211_EXT_FEATURE_AP_PMKSA_CACHING = 0x22 + NL80211_EXT_FEATURE_AQL = 0x28 + NL80211_EXT_FEATURE_BEACON_PROTECTION_CLIENT = 0x2e + NL80211_EXT_FEATURE_BEACON_PROTECTION = 0x29 + NL80211_EXT_FEATURE_BEACON_RATE_HE = 0x36 + NL80211_EXT_FEATURE_BEACON_RATE_HT = 0x7 + NL80211_EXT_FEATURE_BEACON_RATE_LEGACY = 0x6 + NL80211_EXT_FEATURE_BEACON_RATE_VHT = 0x8 + NL80211_EXT_FEATURE_BSS_PARENT_TSF = 0x4 + NL80211_EXT_FEATURE_CAN_REPLACE_PTK0 = 0x1f + NL80211_EXT_FEATURE_CONTROL_PORT_NO_PREAUTH = 0x2a + NL80211_EXT_FEATURE_CONTROL_PORT_OVER_NL80211 = 0x1a + NL80211_EXT_FEATURE_CONTROL_PORT_OVER_NL80211_TX_STATUS = 0x30 + NL80211_EXT_FEATURE_CQM_RSSI_LIST = 0xd + NL80211_EXT_FEATURE_DATA_ACK_SIGNAL_SUPPORT = 0x1b + NL80211_EXT_FEATURE_DEL_IBSS_STA = 0x2c + NL80211_EXT_FEATURE_DFS_OFFLOAD = 0x19 + NL80211_EXT_FEATURE_ENABLE_FTM_RESPONDER = 0x20 + NL80211_EXT_FEATURE_EXT_KEY_ID = 0x24 + NL80211_EXT_FEATURE_FILS_DISCOVERY = 0x34 + NL80211_EXT_FEATURE_FILS_MAX_CHANNEL_TIME = 0x11 + NL80211_EXT_FEATURE_FILS_SK_OFFLOAD = 0xe + NL80211_EXT_FEATURE_FILS_STA = 0x9 + NL80211_EXT_FEATURE_HIGH_ACCURACY_SCAN = 0x18 + NL80211_EXT_FEATURE_LOW_POWER_SCAN = 0x17 + NL80211_EXT_FEATURE_LOW_SPAN_SCAN = 0x16 + NL80211_EXT_FEATURE_MFP_OPTIONAL = 0x15 + NL80211_EXT_FEATURE_MGMT_TX_RANDOM_TA = 0xa + NL80211_EXT_FEATURE_MGMT_TX_RANDOM_TA_CONNECTED = 0xb + NL80211_EXT_FEATURE_MULTICAST_REGISTRATIONS = 0x2d + NL80211_EXT_FEATURE_MU_MIMO_AIR_SNIFFER = 0x2 + NL80211_EXT_FEATURE_OCE_PROBE_REQ_DEFERRAL_SUPPRESSION = 0x14 + NL80211_EXT_FEATURE_OCE_PROBE_REQ_HIGH_TX_RATE = 0x13 + NL80211_EXT_FEATURE_OPERATING_CHANNEL_VALIDATION = 0x31 + NL80211_EXT_FEATURE_PROTECTED_TWT = 0x2b + NL80211_EXT_FEATURE_PROT_RANGE_NEGO_AND_MEASURE = 0x39 + NL80211_EXT_FEATURE_RRM = 0x1 + NL80211_EXT_FEATURE_SAE_OFFLOAD_AP = 0x33 + NL80211_EXT_FEATURE_SAE_OFFLOAD = 0x26 + NL80211_EXT_FEATURE_SCAN_FREQ_KHZ = 0x2f + NL80211_EXT_FEATURE_SCAN_MIN_PREQ_CONTENT = 0x1e + NL80211_EXT_FEATURE_SCAN_RANDOM_SN = 0x1d + NL80211_EXT_FEATURE_SCAN_START_TIME = 0x3 + NL80211_EXT_FEATURE_SCHED_SCAN_BAND_SPECIFIC_RSSI_THOLD = 0x23 + NL80211_EXT_FEATURE_SCHED_SCAN_RELATIVE_RSSI = 0xc + NL80211_EXT_FEATURE_SECURE_LTF = 0x37 + NL80211_EXT_FEATURE_SECURE_RTT = 0x38 + NL80211_EXT_FEATURE_SET_SCAN_DWELL = 0x5 + NL80211_EXT_FEATURE_STA_TX_PWR = 0x25 + NL80211_EXT_FEATURE_TXQS = 0x1c + NL80211_EXT_FEATURE_UNSOL_BCAST_PROBE_RESP = 0x35 + NL80211_EXT_FEATURE_VHT_IBSS = 0x0 + NL80211_EXT_FEATURE_VLAN_OFFLOAD = 0x27 + NL80211_FEATURE_ACKTO_ESTIMATION = 0x800000 + NL80211_FEATURE_ACTIVE_MONITOR = 0x20000 + NL80211_FEATURE_ADVERTISE_CHAN_LIMITS = 0x4000 + NL80211_FEATURE_AP_MODE_CHAN_WIDTH_CHANGE = 0x40000 + NL80211_FEATURE_AP_SCAN = 0x100 + NL80211_FEATURE_CELL_BASE_REG_HINTS = 0x8 + NL80211_FEATURE_DS_PARAM_SET_IE_IN_PROBES = 0x80000 + NL80211_FEATURE_DYNAMIC_SMPS = 0x2000000 + NL80211_FEATURE_FULL_AP_CLIENT_STATE = 0x8000 + NL80211_FEATURE_HT_IBSS = 0x2 + NL80211_FEATURE_INACTIVITY_TIMER = 0x4 + NL80211_FEATURE_LOW_PRIORITY_SCAN = 0x40 + NL80211_FEATURE_MAC_ON_CREATE = 0x8000000 + NL80211_FEATURE_ND_RANDOM_MAC_ADDR = 0x80000000 + NL80211_FEATURE_NEED_OBSS_SCAN = 0x400 + NL80211_FEATURE_P2P_DEVICE_NEEDS_CHANNEL = 0x10 + NL80211_FEATURE_P2P_GO_CTWIN = 0x800 + NL80211_FEATURE_P2P_GO_OPPPS = 0x1000 + NL80211_FEATURE_QUIET = 0x200000 + NL80211_FEATURE_SAE = 0x20 + NL80211_FEATURE_SCAN_FLUSH = 0x80 + NL80211_FEATURE_SCAN_RANDOM_MAC_ADDR = 0x20000000 + NL80211_FEATURE_SCHED_SCAN_RANDOM_MAC_ADDR = 0x40000000 + NL80211_FEATURE_SK_TX_STATUS = 0x1 + NL80211_FEATURE_STATIC_SMPS = 0x1000000 + NL80211_FEATURE_SUPPORTS_WMM_ADMISSION = 0x4000000 + NL80211_FEATURE_TDLS_CHANNEL_SWITCH = 0x10000000 + NL80211_FEATURE_TX_POWER_INSERTION = 0x400000 + NL80211_FEATURE_USERSPACE_MPM = 0x10000 + NL80211_FEATURE_VIF_TXPOWER = 0x200 + NL80211_FEATURE_WFA_TPC_IE_IN_PROBES = 0x100000 + NL80211_FILS_DISCOVERY_ATTR_INT_MAX = 0x2 + NL80211_FILS_DISCOVERY_ATTR_INT_MIN = 0x1 + NL80211_FILS_DISCOVERY_ATTR_MAX = 0x3 + NL80211_FILS_DISCOVERY_ATTR_TMPL = 0x3 + NL80211_FILS_DISCOVERY_TMPL_MIN_LEN = 0x2a + NL80211_FREQUENCY_ATTR_16MHZ = 0x19 + NL80211_FREQUENCY_ATTR_1MHZ = 0x15 + NL80211_FREQUENCY_ATTR_2MHZ = 0x16 + NL80211_FREQUENCY_ATTR_4MHZ = 0x17 + NL80211_FREQUENCY_ATTR_8MHZ = 0x18 + NL80211_FREQUENCY_ATTR_DFS_CAC_TIME = 0xd + NL80211_FREQUENCY_ATTR_DFS_STATE = 0x7 + NL80211_FREQUENCY_ATTR_DFS_TIME = 0x8 + NL80211_FREQUENCY_ATTR_DISABLED = 0x2 + NL80211_FREQUENCY_ATTR_FREQ = 0x1 + NL80211_FREQUENCY_ATTR_GO_CONCURRENT = 0xf + NL80211_FREQUENCY_ATTR_INDOOR_ONLY = 0xe + NL80211_FREQUENCY_ATTR_IR_CONCURRENT = 0xf + NL80211_FREQUENCY_ATTR_MAX = 0x1b + NL80211_FREQUENCY_ATTR_MAX_TX_POWER = 0x6 + NL80211_FREQUENCY_ATTR_NO_10MHZ = 0x11 + NL80211_FREQUENCY_ATTR_NO_160MHZ = 0xc + NL80211_FREQUENCY_ATTR_NO_20MHZ = 0x10 + NL80211_FREQUENCY_ATTR_NO_80MHZ = 0xb + NL80211_FREQUENCY_ATTR_NO_HE = 0x13 + NL80211_FREQUENCY_ATTR_NO_HT40_MINUS = 0x9 + NL80211_FREQUENCY_ATTR_NO_HT40_PLUS = 0xa + NL80211_FREQUENCY_ATTR_NO_IBSS = 0x3 + NL80211_FREQUENCY_ATTR_NO_IR = 0x3 + NL80211_FREQUENCY_ATTR_OFFSET = 0x14 + NL80211_FREQUENCY_ATTR_PASSIVE_SCAN = 0x3 + NL80211_FREQUENCY_ATTR_RADAR = 0x5 + NL80211_FREQUENCY_ATTR_WMM = 0x12 + NL80211_FTM_RESP_ATTR_CIVICLOC = 0x3 + NL80211_FTM_RESP_ATTR_ENABLED = 0x1 + NL80211_FTM_RESP_ATTR_LCI = 0x2 + NL80211_FTM_RESP_ATTR_MAX = 0x3 + NL80211_FTM_STATS_ASAP_NUM = 0x4 + NL80211_FTM_STATS_FAILED_NUM = 0x3 + NL80211_FTM_STATS_MAX = 0xa + NL80211_FTM_STATS_NON_ASAP_NUM = 0x5 + NL80211_FTM_STATS_OUT_OF_WINDOW_TRIGGERS_NUM = 0x9 + NL80211_FTM_STATS_PAD = 0xa + NL80211_FTM_STATS_PARTIAL_NUM = 0x2 + NL80211_FTM_STATS_RESCHEDULE_REQUESTS_NUM = 0x8 + NL80211_FTM_STATS_SUCCESS_NUM = 0x1 + NL80211_FTM_STATS_TOTAL_DURATION_MSEC = 0x6 + NL80211_FTM_STATS_UNKNOWN_TRIGGERS_NUM = 0x7 + NL80211_GENL_NAME = "nl80211" + NL80211_HE_BSS_COLOR_ATTR_COLOR = 0x1 + NL80211_HE_BSS_COLOR_ATTR_DISABLED = 0x2 + NL80211_HE_BSS_COLOR_ATTR_MAX = 0x3 + NL80211_HE_BSS_COLOR_ATTR_PARTIAL = 0x3 + NL80211_HE_MAX_CAPABILITY_LEN = 0x36 + NL80211_HE_MIN_CAPABILITY_LEN = 0x10 + NL80211_HE_NSS_MAX = 0x8 + NL80211_HE_OBSS_PD_ATTR_BSS_COLOR_BITMAP = 0x4 + NL80211_HE_OBSS_PD_ATTR_MAX = 0x6 + NL80211_HE_OBSS_PD_ATTR_MAX_OFFSET = 0x2 + NL80211_HE_OBSS_PD_ATTR_MIN_OFFSET = 0x1 + NL80211_HE_OBSS_PD_ATTR_NON_SRG_MAX_OFFSET = 0x3 + NL80211_HE_OBSS_PD_ATTR_PARTIAL_BSSID_BITMAP = 0x5 + NL80211_HE_OBSS_PD_ATTR_SR_CTRL = 0x6 + NL80211_HIDDEN_SSID_NOT_IN_USE = 0x0 + NL80211_HIDDEN_SSID_ZERO_CONTENTS = 0x2 + NL80211_HIDDEN_SSID_ZERO_LEN = 0x1 + NL80211_HT_CAPABILITY_LEN = 0x1a + NL80211_IFACE_COMB_BI_MIN_GCD = 0x7 + NL80211_IFACE_COMB_LIMITS = 0x1 + NL80211_IFACE_COMB_MAXNUM = 0x2 + NL80211_IFACE_COMB_NUM_CHANNELS = 0x4 + NL80211_IFACE_COMB_RADAR_DETECT_REGIONS = 0x6 + NL80211_IFACE_COMB_RADAR_DETECT_WIDTHS = 0x5 + NL80211_IFACE_COMB_STA_AP_BI_MATCH = 0x3 + NL80211_IFACE_COMB_UNSPEC = 0x0 + NL80211_IFACE_LIMIT_MAX = 0x1 + NL80211_IFACE_LIMIT_TYPES = 0x2 + NL80211_IFACE_LIMIT_UNSPEC = 0x0 + NL80211_IFTYPE_ADHOC = 0x1 + NL80211_IFTYPE_AKM_ATTR_IFTYPES = 0x1 + NL80211_IFTYPE_AKM_ATTR_MAX = 0x2 + NL80211_IFTYPE_AKM_ATTR_SUITES = 0x2 + NL80211_IFTYPE_AP = 0x3 + NL80211_IFTYPE_AP_VLAN = 0x4 + NL80211_IFTYPE_MAX = 0xc + NL80211_IFTYPE_MESH_POINT = 0x7 + NL80211_IFTYPE_MONITOR = 0x6 + NL80211_IFTYPE_NAN = 0xc + NL80211_IFTYPE_OCB = 0xb + NL80211_IFTYPE_P2P_CLIENT = 0x8 + NL80211_IFTYPE_P2P_DEVICE = 0xa + NL80211_IFTYPE_P2P_GO = 0x9 + NL80211_IFTYPE_STATION = 0x2 + NL80211_IFTYPE_UNSPECIFIED = 0x0 + NL80211_IFTYPE_WDS = 0x5 + NL80211_KCK_EXT_LEN = 0x18 + NL80211_KCK_LEN = 0x10 + NL80211_KEK_EXT_LEN = 0x20 + NL80211_KEK_LEN = 0x10 + NL80211_KEY_CIPHER = 0x3 + NL80211_KEY_DATA = 0x1 + NL80211_KEY_DEFAULT_BEACON = 0xa + NL80211_KEY_DEFAULT = 0x5 + NL80211_KEY_DEFAULT_MGMT = 0x6 + NL80211_KEY_DEFAULT_TYPE_MULTICAST = 0x2 + NL80211_KEY_DEFAULT_TYPES = 0x8 + NL80211_KEY_DEFAULT_TYPE_UNICAST = 0x1 + NL80211_KEY_IDX = 0x2 + NL80211_KEY_MAX = 0xa + NL80211_KEY_MODE = 0x9 + NL80211_KEY_NO_TX = 0x1 + NL80211_KEY_RX_TX = 0x0 + NL80211_KEY_SEQ = 0x4 + NL80211_KEY_SET_TX = 0x2 + NL80211_KEY_TYPE = 0x7 + NL80211_KEYTYPE_GROUP = 0x0 + NL80211_KEYTYPE_PAIRWISE = 0x1 + NL80211_KEYTYPE_PEERKEY = 0x2 + NL80211_MAX_NR_AKM_SUITES = 0x2 + NL80211_MAX_NR_CIPHER_SUITES = 0x5 + NL80211_MAX_SUPP_HT_RATES = 0x4d + NL80211_MAX_SUPP_RATES = 0x20 + NL80211_MAX_SUPP_REG_RULES = 0x80 + NL80211_MESHCONF_ATTR_MAX = 0x1f + NL80211_MESHCONF_AUTO_OPEN_PLINKS = 0x7 + NL80211_MESHCONF_AWAKE_WINDOW = 0x1b + NL80211_MESHCONF_CONFIRM_TIMEOUT = 0x2 + NL80211_MESHCONF_CONNECTED_TO_AS = 0x1f + NL80211_MESHCONF_CONNECTED_TO_GATE = 0x1d + NL80211_MESHCONF_ELEMENT_TTL = 0xf + NL80211_MESHCONF_FORWARDING = 0x13 + NL80211_MESHCONF_GATE_ANNOUNCEMENTS = 0x11 + NL80211_MESHCONF_HOLDING_TIMEOUT = 0x3 + NL80211_MESHCONF_HT_OPMODE = 0x16 + NL80211_MESHCONF_HWMP_ACTIVE_PATH_TIMEOUT = 0xb + NL80211_MESHCONF_HWMP_CONFIRMATION_INTERVAL = 0x19 + NL80211_MESHCONF_HWMP_MAX_PREQ_RETRIES = 0x8 + NL80211_MESHCONF_HWMP_NET_DIAM_TRVS_TIME = 0xd + NL80211_MESHCONF_HWMP_PATH_TO_ROOT_TIMEOUT = 0x17 + NL80211_MESHCONF_HWMP_PERR_MIN_INTERVAL = 0x12 + NL80211_MESHCONF_HWMP_PREQ_MIN_INTERVAL = 0xc + NL80211_MESHCONF_HWMP_RANN_INTERVAL = 0x10 + NL80211_MESHCONF_HWMP_ROOT_INTERVAL = 0x18 + NL80211_MESHCONF_HWMP_ROOTMODE = 0xe + NL80211_MESHCONF_MAX_PEER_LINKS = 0x4 + NL80211_MESHCONF_MAX_RETRIES = 0x5 + NL80211_MESHCONF_MIN_DISCOVERY_TIMEOUT = 0xa + NL80211_MESHCONF_NOLEARN = 0x1e + NL80211_MESHCONF_PATH_REFRESH_TIME = 0x9 + NL80211_MESHCONF_PLINK_TIMEOUT = 0x1c + NL80211_MESHCONF_POWER_MODE = 0x1a + NL80211_MESHCONF_RETRY_TIMEOUT = 0x1 + NL80211_MESHCONF_RSSI_THRESHOLD = 0x14 + NL80211_MESHCONF_SYNC_OFFSET_MAX_NEIGHBOR = 0x15 + NL80211_MESHCONF_TTL = 0x6 + NL80211_MESH_POWER_ACTIVE = 0x1 + NL80211_MESH_POWER_DEEP_SLEEP = 0x3 + NL80211_MESH_POWER_LIGHT_SLEEP = 0x2 + NL80211_MESH_POWER_MAX = 0x3 + NL80211_MESH_POWER_UNKNOWN = 0x0 + NL80211_MESH_SETUP_ATTR_MAX = 0x8 + NL80211_MESH_SETUP_AUTH_PROTOCOL = 0x8 + NL80211_MESH_SETUP_ENABLE_VENDOR_METRIC = 0x2 + NL80211_MESH_SETUP_ENABLE_VENDOR_PATH_SEL = 0x1 + NL80211_MESH_SETUP_ENABLE_VENDOR_SYNC = 0x6 + NL80211_MESH_SETUP_IE = 0x3 + NL80211_MESH_SETUP_USERSPACE_AMPE = 0x5 + NL80211_MESH_SETUP_USERSPACE_AUTH = 0x4 + NL80211_MESH_SETUP_USERSPACE_MPM = 0x7 + NL80211_MESH_SETUP_VENDOR_PATH_SEL_IE = 0x3 + NL80211_MFP_NO = 0x0 + NL80211_MFP_OPTIONAL = 0x2 + NL80211_MFP_REQUIRED = 0x1 + NL80211_MIN_REMAIN_ON_CHANNEL_TIME = 0xa + NL80211_MNTR_FLAG_ACTIVE = 0x6 + NL80211_MNTR_FLAG_CONTROL = 0x3 + NL80211_MNTR_FLAG_COOK_FRAMES = 0x5 + NL80211_MNTR_FLAG_FCSFAIL = 0x1 + NL80211_MNTR_FLAG_MAX = 0x6 + NL80211_MNTR_FLAG_OTHER_BSS = 0x4 + NL80211_MNTR_FLAG_PLCPFAIL = 0x2 + NL80211_MPATH_FLAG_ACTIVE = 0x1 + NL80211_MPATH_FLAG_FIXED = 0x8 + NL80211_MPATH_FLAG_RESOLVED = 0x10 + NL80211_MPATH_FLAG_RESOLVING = 0x2 + NL80211_MPATH_FLAG_SN_VALID = 0x4 + NL80211_MPATH_INFO_DISCOVERY_RETRIES = 0x7 + NL80211_MPATH_INFO_DISCOVERY_TIMEOUT = 0x6 + NL80211_MPATH_INFO_EXPTIME = 0x4 + NL80211_MPATH_INFO_FLAGS = 0x5 + NL80211_MPATH_INFO_FRAME_QLEN = 0x1 + NL80211_MPATH_INFO_HOP_COUNT = 0x8 + NL80211_MPATH_INFO_MAX = 0x9 + NL80211_MPATH_INFO_METRIC = 0x3 + NL80211_MPATH_INFO_PATH_CHANGE = 0x9 + NL80211_MPATH_INFO_SN = 0x2 + NL80211_MULTICAST_GROUP_CONFIG = "config" + NL80211_MULTICAST_GROUP_MLME = "mlme" + NL80211_MULTICAST_GROUP_NAN = "nan" + NL80211_MULTICAST_GROUP_REG = "regulatory" + NL80211_MULTICAST_GROUP_SCAN = "scan" + NL80211_MULTICAST_GROUP_TESTMODE = "testmode" + NL80211_MULTICAST_GROUP_VENDOR = "vendor" + NL80211_NAN_FUNC_ATTR_MAX = 0x10 + NL80211_NAN_FUNC_CLOSE_RANGE = 0x9 + NL80211_NAN_FUNC_FOLLOW_UP = 0x2 + NL80211_NAN_FUNC_FOLLOW_UP_DEST = 0x8 + NL80211_NAN_FUNC_FOLLOW_UP_ID = 0x6 + NL80211_NAN_FUNC_FOLLOW_UP_REQ_ID = 0x7 + NL80211_NAN_FUNC_INSTANCE_ID = 0xf + NL80211_NAN_FUNC_MAX_TYPE = 0x2 + NL80211_NAN_FUNC_PUBLISH_BCAST = 0x4 + NL80211_NAN_FUNC_PUBLISH = 0x0 + NL80211_NAN_FUNC_PUBLISH_TYPE = 0x3 + NL80211_NAN_FUNC_RX_MATCH_FILTER = 0xd + NL80211_NAN_FUNC_SERVICE_ID = 0x2 + NL80211_NAN_FUNC_SERVICE_ID_LEN = 0x6 + NL80211_NAN_FUNC_SERVICE_INFO = 0xb + NL80211_NAN_FUNC_SERVICE_SPEC_INFO_MAX_LEN = 0xff + NL80211_NAN_FUNC_SRF = 0xc + NL80211_NAN_FUNC_SRF_MAX_LEN = 0xff + NL80211_NAN_FUNC_SUBSCRIBE_ACTIVE = 0x5 + NL80211_NAN_FUNC_SUBSCRIBE = 0x1 + NL80211_NAN_FUNC_TERM_REASON = 0x10 + NL80211_NAN_FUNC_TERM_REASON_ERROR = 0x2 + NL80211_NAN_FUNC_TERM_REASON_TTL_EXPIRED = 0x1 + NL80211_NAN_FUNC_TERM_REASON_USER_REQUEST = 0x0 + NL80211_NAN_FUNC_TTL = 0xa + NL80211_NAN_FUNC_TX_MATCH_FILTER = 0xe + NL80211_NAN_FUNC_TYPE = 0x1 + NL80211_NAN_MATCH_ATTR_MAX = 0x2 + NL80211_NAN_MATCH_FUNC_LOCAL = 0x1 + NL80211_NAN_MATCH_FUNC_PEER = 0x2 + NL80211_NAN_SOLICITED_PUBLISH = 0x1 + NL80211_NAN_SRF_ATTR_MAX = 0x4 + NL80211_NAN_SRF_BF = 0x2 + NL80211_NAN_SRF_BF_IDX = 0x3 + NL80211_NAN_SRF_INCLUDE = 0x1 + NL80211_NAN_SRF_MAC_ADDRS = 0x4 + NL80211_NAN_UNSOLICITED_PUBLISH = 0x2 + NL80211_NUM_ACS = 0x4 + NL80211_P2P_PS_SUPPORTED = 0x1 + NL80211_P2P_PS_UNSUPPORTED = 0x0 + NL80211_PKTPAT_MASK = 0x1 + NL80211_PKTPAT_OFFSET = 0x3 + NL80211_PKTPAT_PATTERN = 0x2 + NL80211_PLINK_ACTION_BLOCK = 0x2 + NL80211_PLINK_ACTION_NO_ACTION = 0x0 + NL80211_PLINK_ACTION_OPEN = 0x1 + NL80211_PLINK_BLOCKED = 0x6 + NL80211_PLINK_CNF_RCVD = 0x3 + NL80211_PLINK_ESTAB = 0x4 + NL80211_PLINK_HOLDING = 0x5 + NL80211_PLINK_LISTEN = 0x0 + NL80211_PLINK_OPN_RCVD = 0x2 + NL80211_PLINK_OPN_SNT = 0x1 + NL80211_PMKSA_CANDIDATE_BSSID = 0x2 + NL80211_PMKSA_CANDIDATE_INDEX = 0x1 + NL80211_PMKSA_CANDIDATE_PREAUTH = 0x3 + NL80211_PMSR_ATTR_MAX = 0x5 + NL80211_PMSR_ATTR_MAX_PEERS = 0x1 + NL80211_PMSR_ATTR_PEERS = 0x5 + NL80211_PMSR_ATTR_RANDOMIZE_MAC_ADDR = 0x3 + NL80211_PMSR_ATTR_REPORT_AP_TSF = 0x2 + NL80211_PMSR_ATTR_TYPE_CAPA = 0x4 + NL80211_PMSR_FTM_CAPA_ATTR_ASAP = 0x1 + NL80211_PMSR_FTM_CAPA_ATTR_BANDWIDTHS = 0x6 + NL80211_PMSR_FTM_CAPA_ATTR_MAX_BURSTS_EXPONENT = 0x7 + NL80211_PMSR_FTM_CAPA_ATTR_MAX = 0xa + NL80211_PMSR_FTM_CAPA_ATTR_MAX_FTMS_PER_BURST = 0x8 + NL80211_PMSR_FTM_CAPA_ATTR_NON_ASAP = 0x2 + NL80211_PMSR_FTM_CAPA_ATTR_NON_TRIGGER_BASED = 0xa + NL80211_PMSR_FTM_CAPA_ATTR_PREAMBLES = 0x5 + NL80211_PMSR_FTM_CAPA_ATTR_REQ_CIVICLOC = 0x4 + NL80211_PMSR_FTM_CAPA_ATTR_REQ_LCI = 0x3 + NL80211_PMSR_FTM_CAPA_ATTR_TRIGGER_BASED = 0x9 + NL80211_PMSR_FTM_FAILURE_BAD_CHANGED_PARAMS = 0x7 + NL80211_PMSR_FTM_FAILURE_INVALID_TIMESTAMP = 0x5 + NL80211_PMSR_FTM_FAILURE_NO_RESPONSE = 0x1 + NL80211_PMSR_FTM_FAILURE_PEER_BUSY = 0x6 + NL80211_PMSR_FTM_FAILURE_PEER_NOT_CAPABLE = 0x4 + NL80211_PMSR_FTM_FAILURE_REJECTED = 0x2 + NL80211_PMSR_FTM_FAILURE_UNSPECIFIED = 0x0 + NL80211_PMSR_FTM_FAILURE_WRONG_CHANNEL = 0x3 + NL80211_PMSR_FTM_REQ_ATTR_ASAP = 0x1 + NL80211_PMSR_FTM_REQ_ATTR_BURST_DURATION = 0x5 + NL80211_PMSR_FTM_REQ_ATTR_BURST_PERIOD = 0x4 + NL80211_PMSR_FTM_REQ_ATTR_FTMS_PER_BURST = 0x6 + NL80211_PMSR_FTM_REQ_ATTR_LMR_FEEDBACK = 0xc + NL80211_PMSR_FTM_REQ_ATTR_MAX = 0xd + NL80211_PMSR_FTM_REQ_ATTR_NON_TRIGGER_BASED = 0xb + NL80211_PMSR_FTM_REQ_ATTR_NUM_BURSTS_EXP = 0x3 + NL80211_PMSR_FTM_REQ_ATTR_NUM_FTMR_RETRIES = 0x7 + NL80211_PMSR_FTM_REQ_ATTR_PREAMBLE = 0x2 + NL80211_PMSR_FTM_REQ_ATTR_REQUEST_CIVICLOC = 0x9 + NL80211_PMSR_FTM_REQ_ATTR_REQUEST_LCI = 0x8 + NL80211_PMSR_FTM_REQ_ATTR_TRIGGER_BASED = 0xa + NL80211_PMSR_FTM_RESP_ATTR_BURST_DURATION = 0x7 + NL80211_PMSR_FTM_RESP_ATTR_BURST_INDEX = 0x2 + NL80211_PMSR_FTM_RESP_ATTR_BUSY_RETRY_TIME = 0x5 + NL80211_PMSR_FTM_RESP_ATTR_CIVICLOC = 0x14 + NL80211_PMSR_FTM_RESP_ATTR_DIST_AVG = 0x10 + NL80211_PMSR_FTM_RESP_ATTR_DIST_SPREAD = 0x12 + NL80211_PMSR_FTM_RESP_ATTR_DIST_VARIANCE = 0x11 + NL80211_PMSR_FTM_RESP_ATTR_FAIL_REASON = 0x1 + NL80211_PMSR_FTM_RESP_ATTR_FTMS_PER_BURST = 0x8 + NL80211_PMSR_FTM_RESP_ATTR_LCI = 0x13 + NL80211_PMSR_FTM_RESP_ATTR_MAX = 0x15 + NL80211_PMSR_FTM_RESP_ATTR_NUM_BURSTS_EXP = 0x6 + NL80211_PMSR_FTM_RESP_ATTR_NUM_FTMR_ATTEMPTS = 0x3 + NL80211_PMSR_FTM_RESP_ATTR_NUM_FTMR_SUCCESSES = 0x4 + NL80211_PMSR_FTM_RESP_ATTR_PAD = 0x15 + NL80211_PMSR_FTM_RESP_ATTR_RSSI_AVG = 0x9 + NL80211_PMSR_FTM_RESP_ATTR_RSSI_SPREAD = 0xa + NL80211_PMSR_FTM_RESP_ATTR_RTT_AVG = 0xd + NL80211_PMSR_FTM_RESP_ATTR_RTT_SPREAD = 0xf + NL80211_PMSR_FTM_RESP_ATTR_RTT_VARIANCE = 0xe + NL80211_PMSR_FTM_RESP_ATTR_RX_RATE = 0xc + NL80211_PMSR_FTM_RESP_ATTR_TX_RATE = 0xb + NL80211_PMSR_PEER_ATTR_ADDR = 0x1 + NL80211_PMSR_PEER_ATTR_CHAN = 0x2 + NL80211_PMSR_PEER_ATTR_MAX = 0x4 + NL80211_PMSR_PEER_ATTR_REQ = 0x3 + NL80211_PMSR_PEER_ATTR_RESP = 0x4 + NL80211_PMSR_REQ_ATTR_DATA = 0x1 + NL80211_PMSR_REQ_ATTR_GET_AP_TSF = 0x2 + NL80211_PMSR_REQ_ATTR_MAX = 0x2 + NL80211_PMSR_RESP_ATTR_AP_TSF = 0x4 + NL80211_PMSR_RESP_ATTR_DATA = 0x1 + NL80211_PMSR_RESP_ATTR_FINAL = 0x5 + NL80211_PMSR_RESP_ATTR_HOST_TIME = 0x3 + NL80211_PMSR_RESP_ATTR_MAX = 0x6 + NL80211_PMSR_RESP_ATTR_PAD = 0x6 + NL80211_PMSR_RESP_ATTR_STATUS = 0x2 + NL80211_PMSR_STATUS_FAILURE = 0x3 + NL80211_PMSR_STATUS_REFUSED = 0x1 + NL80211_PMSR_STATUS_SUCCESS = 0x0 + NL80211_PMSR_STATUS_TIMEOUT = 0x2 + NL80211_PMSR_TYPE_FTM = 0x1 + NL80211_PMSR_TYPE_INVALID = 0x0 + NL80211_PMSR_TYPE_MAX = 0x1 + NL80211_PREAMBLE_DMG = 0x3 + NL80211_PREAMBLE_HE = 0x4 + NL80211_PREAMBLE_HT = 0x1 + NL80211_PREAMBLE_LEGACY = 0x0 + NL80211_PREAMBLE_VHT = 0x2 + NL80211_PROBE_RESP_OFFLOAD_SUPPORT_80211U = 0x8 + NL80211_PROBE_RESP_OFFLOAD_SUPPORT_P2P = 0x4 + NL80211_PROBE_RESP_OFFLOAD_SUPPORT_WPS2 = 0x2 + NL80211_PROBE_RESP_OFFLOAD_SUPPORT_WPS = 0x1 + NL80211_PROTOCOL_FEATURE_SPLIT_WIPHY_DUMP = 0x1 + NL80211_PS_DISABLED = 0x0 + NL80211_PS_ENABLED = 0x1 + NL80211_RADAR_CAC_ABORTED = 0x2 + NL80211_RADAR_CAC_FINISHED = 0x1 + NL80211_RADAR_CAC_STARTED = 0x5 + NL80211_RADAR_DETECTED = 0x0 + NL80211_RADAR_NOP_FINISHED = 0x3 + NL80211_RADAR_PRE_CAC_EXPIRED = 0x4 + NL80211_RATE_INFO_10_MHZ_WIDTH = 0xb + NL80211_RATE_INFO_160_MHZ_WIDTH = 0xa + NL80211_RATE_INFO_40_MHZ_WIDTH = 0x3 + NL80211_RATE_INFO_5_MHZ_WIDTH = 0xc + NL80211_RATE_INFO_80_MHZ_WIDTH = 0x8 + NL80211_RATE_INFO_80P80_MHZ_WIDTH = 0x9 + NL80211_RATE_INFO_BITRATE32 = 0x5 + NL80211_RATE_INFO_BITRATE = 0x1 + NL80211_RATE_INFO_HE_1XLTF = 0x0 + NL80211_RATE_INFO_HE_2XLTF = 0x1 + NL80211_RATE_INFO_HE_4XLTF = 0x2 + NL80211_RATE_INFO_HE_DCM = 0x10 + NL80211_RATE_INFO_HE_GI_0_8 = 0x0 + NL80211_RATE_INFO_HE_GI_1_6 = 0x1 + NL80211_RATE_INFO_HE_GI_3_2 = 0x2 + NL80211_RATE_INFO_HE_GI = 0xf + NL80211_RATE_INFO_HE_MCS = 0xd + NL80211_RATE_INFO_HE_NSS = 0xe + NL80211_RATE_INFO_HE_RU_ALLOC_106 = 0x2 + NL80211_RATE_INFO_HE_RU_ALLOC_242 = 0x3 + NL80211_RATE_INFO_HE_RU_ALLOC_26 = 0x0 + NL80211_RATE_INFO_HE_RU_ALLOC_2x996 = 0x6 + NL80211_RATE_INFO_HE_RU_ALLOC_484 = 0x4 + NL80211_RATE_INFO_HE_RU_ALLOC_52 = 0x1 + NL80211_RATE_INFO_HE_RU_ALLOC_996 = 0x5 + NL80211_RATE_INFO_HE_RU_ALLOC = 0x11 + NL80211_RATE_INFO_MAX = 0x16 + NL80211_RATE_INFO_MCS = 0x2 + NL80211_RATE_INFO_SHORT_GI = 0x4 + NL80211_RATE_INFO_VHT_MCS = 0x6 + NL80211_RATE_INFO_VHT_NSS = 0x7 + NL80211_REGDOM_SET_BY_CORE = 0x0 + NL80211_REGDOM_SET_BY_COUNTRY_IE = 0x3 + NL80211_REGDOM_SET_BY_DRIVER = 0x2 + NL80211_REGDOM_SET_BY_USER = 0x1 + NL80211_REGDOM_TYPE_COUNTRY = 0x0 + NL80211_REGDOM_TYPE_CUSTOM_WORLD = 0x2 + NL80211_REGDOM_TYPE_INTERSECTION = 0x3 + NL80211_REGDOM_TYPE_WORLD = 0x1 + NL80211_REG_RULE_ATTR_MAX = 0x7 + NL80211_REKEY_DATA_AKM = 0x4 + NL80211_REKEY_DATA_KCK = 0x2 + NL80211_REKEY_DATA_KEK = 0x1 + NL80211_REKEY_DATA_REPLAY_CTR = 0x3 + NL80211_REPLAY_CTR_LEN = 0x8 + NL80211_RRF_AUTO_BW = 0x800 + NL80211_RRF_DFS = 0x10 + NL80211_RRF_GO_CONCURRENT = 0x1000 + NL80211_RRF_IR_CONCURRENT = 0x1000 + NL80211_RRF_NO_160MHZ = 0x10000 + NL80211_RRF_NO_80MHZ = 0x8000 + NL80211_RRF_NO_CCK = 0x2 + NL80211_RRF_NO_HE = 0x20000 + NL80211_RRF_NO_HT40 = 0x6000 + NL80211_RRF_NO_HT40MINUS = 0x2000 + NL80211_RRF_NO_HT40PLUS = 0x4000 + NL80211_RRF_NO_IBSS = 0x80 + NL80211_RRF_NO_INDOOR = 0x4 + NL80211_RRF_NO_IR_ALL = 0x180 + NL80211_RRF_NO_IR = 0x80 + NL80211_RRF_NO_OFDM = 0x1 + NL80211_RRF_NO_OUTDOOR = 0x8 + NL80211_RRF_PASSIVE_SCAN = 0x80 + NL80211_RRF_PTMP_ONLY = 0x40 + NL80211_RRF_PTP_ONLY = 0x20 + NL80211_RXMGMT_FLAG_ANSWERED = 0x1 + NL80211_RXMGMT_FLAG_EXTERNAL_AUTH = 0x2 + NL80211_SAE_PWE_BOTH = 0x3 + NL80211_SAE_PWE_HASH_TO_ELEMENT = 0x2 + NL80211_SAE_PWE_HUNT_AND_PECK = 0x1 + NL80211_SAE_PWE_UNSPECIFIED = 0x0 + NL80211_SAR_ATTR_MAX = 0x2 + NL80211_SAR_ATTR_SPECS = 0x2 + NL80211_SAR_ATTR_SPECS_END_FREQ = 0x4 + NL80211_SAR_ATTR_SPECS_MAX = 0x4 + NL80211_SAR_ATTR_SPECS_POWER = 0x1 + NL80211_SAR_ATTR_SPECS_RANGE_INDEX = 0x2 + NL80211_SAR_ATTR_SPECS_START_FREQ = 0x3 + NL80211_SAR_ATTR_TYPE = 0x1 + NL80211_SAR_TYPE_POWER = 0x0 + NL80211_SCAN_FLAG_ACCEPT_BCAST_PROBE_RESP = 0x20 + NL80211_SCAN_FLAG_AP = 0x4 + NL80211_SCAN_FLAG_COLOCATED_6GHZ = 0x4000 + NL80211_SCAN_FLAG_FILS_MAX_CHANNEL_TIME = 0x10 + NL80211_SCAN_FLAG_FLUSH = 0x2 + NL80211_SCAN_FLAG_FREQ_KHZ = 0x2000 + NL80211_SCAN_FLAG_HIGH_ACCURACY = 0x400 + NL80211_SCAN_FLAG_LOW_POWER = 0x200 + NL80211_SCAN_FLAG_LOW_PRIORITY = 0x1 + NL80211_SCAN_FLAG_LOW_SPAN = 0x100 + NL80211_SCAN_FLAG_MIN_PREQ_CONTENT = 0x1000 + NL80211_SCAN_FLAG_OCE_PROBE_REQ_DEFERRAL_SUPPRESSION = 0x80 + NL80211_SCAN_FLAG_OCE_PROBE_REQ_HIGH_TX_RATE = 0x40 + NL80211_SCAN_FLAG_RANDOM_ADDR = 0x8 + NL80211_SCAN_FLAG_RANDOM_SN = 0x800 + NL80211_SCAN_RSSI_THOLD_OFF = -0x12c + NL80211_SCHED_SCAN_MATCH_ATTR_BSSID = 0x5 + NL80211_SCHED_SCAN_MATCH_ATTR_MAX = 0x6 + NL80211_SCHED_SCAN_MATCH_ATTR_RELATIVE_RSSI = 0x3 + NL80211_SCHED_SCAN_MATCH_ATTR_RSSI_ADJUST = 0x4 + NL80211_SCHED_SCAN_MATCH_ATTR_RSSI = 0x2 + NL80211_SCHED_SCAN_MATCH_ATTR_SSID = 0x1 + NL80211_SCHED_SCAN_MATCH_PER_BAND_RSSI = 0x6 + NL80211_SCHED_SCAN_PLAN_INTERVAL = 0x1 + NL80211_SCHED_SCAN_PLAN_ITERATIONS = 0x2 + NL80211_SCHED_SCAN_PLAN_MAX = 0x2 + NL80211_SMPS_DYNAMIC = 0x2 + NL80211_SMPS_MAX = 0x2 + NL80211_SMPS_OFF = 0x0 + NL80211_SMPS_STATIC = 0x1 + NL80211_STA_BSS_PARAM_BEACON_INTERVAL = 0x5 + NL80211_STA_BSS_PARAM_CTS_PROT = 0x1 + NL80211_STA_BSS_PARAM_DTIM_PERIOD = 0x4 + NL80211_STA_BSS_PARAM_MAX = 0x5 + NL80211_STA_BSS_PARAM_SHORT_PREAMBLE = 0x2 + NL80211_STA_BSS_PARAM_SHORT_SLOT_TIME = 0x3 + NL80211_STA_FLAG_ASSOCIATED = 0x7 + NL80211_STA_FLAG_AUTHENTICATED = 0x5 + NL80211_STA_FLAG_AUTHORIZED = 0x1 + NL80211_STA_FLAG_MAX = 0x7 + NL80211_STA_FLAG_MAX_OLD_API = 0x6 + NL80211_STA_FLAG_MFP = 0x4 + NL80211_STA_FLAG_SHORT_PREAMBLE = 0x2 + NL80211_STA_FLAG_TDLS_PEER = 0x6 + NL80211_STA_FLAG_WME = 0x3 + NL80211_STA_INFO_ACK_SIGNAL_AVG = 0x23 + NL80211_STA_INFO_ACK_SIGNAL = 0x22 + NL80211_STA_INFO_AIRTIME_LINK_METRIC = 0x29 + NL80211_STA_INFO_AIRTIME_WEIGHT = 0x28 + NL80211_STA_INFO_ASSOC_AT_BOOTTIME = 0x2a + NL80211_STA_INFO_BEACON_LOSS = 0x12 + NL80211_STA_INFO_BEACON_RX = 0x1d + NL80211_STA_INFO_BEACON_SIGNAL_AVG = 0x1e + NL80211_STA_INFO_BSS_PARAM = 0xf + NL80211_STA_INFO_CHAIN_SIGNAL_AVG = 0x1a + NL80211_STA_INFO_CHAIN_SIGNAL = 0x19 + NL80211_STA_INFO_CONNECTED_TIME = 0x10 + NL80211_STA_INFO_CONNECTED_TO_AS = 0x2b + NL80211_STA_INFO_CONNECTED_TO_GATE = 0x26 + NL80211_STA_INFO_DATA_ACK_SIGNAL_AVG = 0x23 + NL80211_STA_INFO_EXPECTED_THROUGHPUT = 0x1b + NL80211_STA_INFO_FCS_ERROR_COUNT = 0x25 + NL80211_STA_INFO_INACTIVE_TIME = 0x1 + NL80211_STA_INFO_LLID = 0x4 + NL80211_STA_INFO_LOCAL_PM = 0x14 + NL80211_STA_INFO_MAX = 0x2b + NL80211_STA_INFO_NONPEER_PM = 0x16 + NL80211_STA_INFO_PAD = 0x21 + NL80211_STA_INFO_PEER_PM = 0x15 + NL80211_STA_INFO_PLID = 0x5 + NL80211_STA_INFO_PLINK_STATE = 0x6 + NL80211_STA_INFO_RX_BITRATE = 0xe + NL80211_STA_INFO_RX_BYTES64 = 0x17 + NL80211_STA_INFO_RX_BYTES = 0x2 + NL80211_STA_INFO_RX_DROP_MISC = 0x1c + NL80211_STA_INFO_RX_DURATION = 0x20 + NL80211_STA_INFO_RX_MPDUS = 0x24 + NL80211_STA_INFO_RX_PACKETS = 0x9 + NL80211_STA_INFO_SIGNAL_AVG = 0xd + NL80211_STA_INFO_SIGNAL = 0x7 + NL80211_STA_INFO_STA_FLAGS = 0x11 + NL80211_STA_INFO_TID_STATS = 0x1f + NL80211_STA_INFO_T_OFFSET = 0x13 + NL80211_STA_INFO_TX_BITRATE = 0x8 + NL80211_STA_INFO_TX_BYTES64 = 0x18 + NL80211_STA_INFO_TX_BYTES = 0x3 + NL80211_STA_INFO_TX_DURATION = 0x27 + NL80211_STA_INFO_TX_FAILED = 0xc + NL80211_STA_INFO_TX_PACKETS = 0xa + NL80211_STA_INFO_TX_RETRIES = 0xb + NL80211_STA_WME_MAX = 0x2 + NL80211_STA_WME_MAX_SP = 0x2 + NL80211_STA_WME_UAPSD_QUEUES = 0x1 + NL80211_SURVEY_INFO_CHANNEL_TIME_BUSY = 0x5 + NL80211_SURVEY_INFO_CHANNEL_TIME = 0x4 + NL80211_SURVEY_INFO_CHANNEL_TIME_EXT_BUSY = 0x6 + NL80211_SURVEY_INFO_CHANNEL_TIME_RX = 0x7 + NL80211_SURVEY_INFO_CHANNEL_TIME_TX = 0x8 + NL80211_SURVEY_INFO_FREQUENCY = 0x1 + NL80211_SURVEY_INFO_FREQUENCY_OFFSET = 0xc + NL80211_SURVEY_INFO_IN_USE = 0x3 + NL80211_SURVEY_INFO_MAX = 0xc + NL80211_SURVEY_INFO_NOISE = 0x2 + NL80211_SURVEY_INFO_PAD = 0xa + NL80211_SURVEY_INFO_TIME_BSS_RX = 0xb + NL80211_SURVEY_INFO_TIME_BUSY = 0x5 + NL80211_SURVEY_INFO_TIME = 0x4 + NL80211_SURVEY_INFO_TIME_EXT_BUSY = 0x6 + NL80211_SURVEY_INFO_TIME_RX = 0x7 + NL80211_SURVEY_INFO_TIME_SCAN = 0x9 + NL80211_SURVEY_INFO_TIME_TX = 0x8 + NL80211_TDLS_DISABLE_LINK = 0x4 + NL80211_TDLS_DISCOVERY_REQ = 0x0 + NL80211_TDLS_ENABLE_LINK = 0x3 + NL80211_TDLS_PEER_HE = 0x8 + NL80211_TDLS_PEER_HT = 0x1 + NL80211_TDLS_PEER_VHT = 0x2 + NL80211_TDLS_PEER_WMM = 0x4 + NL80211_TDLS_SETUP = 0x1 + NL80211_TDLS_TEARDOWN = 0x2 + NL80211_TID_CONFIG_ATTR_AMPDU_CTRL = 0x9 + NL80211_TID_CONFIG_ATTR_AMSDU_CTRL = 0xb + NL80211_TID_CONFIG_ATTR_MAX = 0xd + NL80211_TID_CONFIG_ATTR_NOACK = 0x6 + NL80211_TID_CONFIG_ATTR_OVERRIDE = 0x4 + NL80211_TID_CONFIG_ATTR_PAD = 0x1 + NL80211_TID_CONFIG_ATTR_PEER_SUPP = 0x3 + NL80211_TID_CONFIG_ATTR_RETRY_LONG = 0x8 + NL80211_TID_CONFIG_ATTR_RETRY_SHORT = 0x7 + NL80211_TID_CONFIG_ATTR_RTSCTS_CTRL = 0xa + NL80211_TID_CONFIG_ATTR_TIDS = 0x5 + NL80211_TID_CONFIG_ATTR_TX_RATE = 0xd + NL80211_TID_CONFIG_ATTR_TX_RATE_TYPE = 0xc + NL80211_TID_CONFIG_ATTR_VIF_SUPP = 0x2 + NL80211_TID_CONFIG_DISABLE = 0x1 + NL80211_TID_CONFIG_ENABLE = 0x0 + NL80211_TID_STATS_MAX = 0x6 + NL80211_TID_STATS_PAD = 0x5 + NL80211_TID_STATS_RX_MSDU = 0x1 + NL80211_TID_STATS_TX_MSDU = 0x2 + NL80211_TID_STATS_TX_MSDU_FAILED = 0x4 + NL80211_TID_STATS_TX_MSDU_RETRIES = 0x3 + NL80211_TID_STATS_TXQ_STATS = 0x6 + NL80211_TIMEOUT_ASSOC = 0x3 + NL80211_TIMEOUT_AUTH = 0x2 + NL80211_TIMEOUT_SCAN = 0x1 + NL80211_TIMEOUT_UNSPECIFIED = 0x0 + NL80211_TKIP_DATA_OFFSET_ENCR_KEY = 0x0 + NL80211_TKIP_DATA_OFFSET_RX_MIC_KEY = 0x18 + NL80211_TKIP_DATA_OFFSET_TX_MIC_KEY = 0x10 + NL80211_TX_POWER_AUTOMATIC = 0x0 + NL80211_TX_POWER_FIXED = 0x2 + NL80211_TX_POWER_LIMITED = 0x1 + NL80211_TXQ_ATTR_AC = 0x1 + NL80211_TXQ_ATTR_AIFS = 0x5 + NL80211_TXQ_ATTR_CWMAX = 0x4 + NL80211_TXQ_ATTR_CWMIN = 0x3 + NL80211_TXQ_ATTR_MAX = 0x5 + NL80211_TXQ_ATTR_QUEUE = 0x1 + NL80211_TXQ_ATTR_TXOP = 0x2 + NL80211_TXQ_Q_BE = 0x2 + NL80211_TXQ_Q_BK = 0x3 + NL80211_TXQ_Q_VI = 0x1 + NL80211_TXQ_Q_VO = 0x0 + NL80211_TXQ_STATS_BACKLOG_BYTES = 0x1 + NL80211_TXQ_STATS_BACKLOG_PACKETS = 0x2 + NL80211_TXQ_STATS_COLLISIONS = 0x8 + NL80211_TXQ_STATS_DROPS = 0x4 + NL80211_TXQ_STATS_ECN_MARKS = 0x5 + NL80211_TXQ_STATS_FLOWS = 0x3 + NL80211_TXQ_STATS_MAX = 0xb + NL80211_TXQ_STATS_MAX_FLOWS = 0xb + NL80211_TXQ_STATS_OVERLIMIT = 0x6 + NL80211_TXQ_STATS_OVERMEMORY = 0x7 + NL80211_TXQ_STATS_TX_BYTES = 0x9 + NL80211_TXQ_STATS_TX_PACKETS = 0xa + NL80211_TX_RATE_AUTOMATIC = 0x0 + NL80211_TXRATE_DEFAULT_GI = 0x0 + NL80211_TX_RATE_FIXED = 0x2 + NL80211_TXRATE_FORCE_LGI = 0x2 + NL80211_TXRATE_FORCE_SGI = 0x1 + NL80211_TXRATE_GI = 0x4 + NL80211_TXRATE_HE = 0x5 + NL80211_TXRATE_HE_GI = 0x6 + NL80211_TXRATE_HE_LTF = 0x7 + NL80211_TXRATE_HT = 0x2 + NL80211_TXRATE_LEGACY = 0x1 + NL80211_TX_RATE_LIMITED = 0x1 + NL80211_TXRATE_MAX = 0x7 + NL80211_TXRATE_MCS = 0x2 + NL80211_TXRATE_VHT = 0x3 + NL80211_UNSOL_BCAST_PROBE_RESP_ATTR_INT = 0x1 + NL80211_UNSOL_BCAST_PROBE_RESP_ATTR_MAX = 0x2 + NL80211_UNSOL_BCAST_PROBE_RESP_ATTR_TMPL = 0x2 + NL80211_USER_REG_HINT_CELL_BASE = 0x1 + NL80211_USER_REG_HINT_INDOOR = 0x2 + NL80211_USER_REG_HINT_USER = 0x0 + NL80211_VENDOR_ID_IS_LINUX = 0x80000000 + NL80211_VHT_CAPABILITY_LEN = 0xc + NL80211_VHT_NSS_MAX = 0x8 + NL80211_WIPHY_NAME_MAXLEN = 0x40 + NL80211_WMMR_AIFSN = 0x3 + NL80211_WMMR_CW_MAX = 0x2 + NL80211_WMMR_CW_MIN = 0x1 + NL80211_WMMR_MAX = 0x4 + NL80211_WMMR_TXOP = 0x4 + NL80211_WOWLAN_PKTPAT_MASK = 0x1 + NL80211_WOWLAN_PKTPAT_OFFSET = 0x3 + NL80211_WOWLAN_PKTPAT_PATTERN = 0x2 + NL80211_WOWLAN_TCP_DATA_INTERVAL = 0x9 + NL80211_WOWLAN_TCP_DATA_PAYLOAD = 0x6 + NL80211_WOWLAN_TCP_DATA_PAYLOAD_SEQ = 0x7 + NL80211_WOWLAN_TCP_DATA_PAYLOAD_TOKEN = 0x8 + NL80211_WOWLAN_TCP_DST_IPV4 = 0x2 + NL80211_WOWLAN_TCP_DST_MAC = 0x3 + NL80211_WOWLAN_TCP_DST_PORT = 0x5 + NL80211_WOWLAN_TCP_SRC_IPV4 = 0x1 + NL80211_WOWLAN_TCP_SRC_PORT = 0x4 + NL80211_WOWLAN_TCP_WAKE_MASK = 0xb + NL80211_WOWLAN_TCP_WAKE_PAYLOAD = 0xa + NL80211_WOWLAN_TRIG_4WAY_HANDSHAKE = 0x8 + NL80211_WOWLAN_TRIG_ANY = 0x1 + NL80211_WOWLAN_TRIG_DISCONNECT = 0x2 + NL80211_WOWLAN_TRIG_EAP_IDENT_REQUEST = 0x7 + NL80211_WOWLAN_TRIG_GTK_REKEY_FAILURE = 0x6 + NL80211_WOWLAN_TRIG_GTK_REKEY_SUPPORTED = 0x5 + NL80211_WOWLAN_TRIG_MAGIC_PKT = 0x3 + NL80211_WOWLAN_TRIG_NET_DETECT = 0x12 + NL80211_WOWLAN_TRIG_NET_DETECT_RESULTS = 0x13 + NL80211_WOWLAN_TRIG_PKT_PATTERN = 0x4 + NL80211_WOWLAN_TRIG_RFKILL_RELEASE = 0x9 + NL80211_WOWLAN_TRIG_TCP_CONNECTION = 0xe + NL80211_WOWLAN_TRIG_WAKEUP_PKT_80211 = 0xa + NL80211_WOWLAN_TRIG_WAKEUP_PKT_80211_LEN = 0xb + NL80211_WOWLAN_TRIG_WAKEUP_PKT_8023 = 0xc + NL80211_WOWLAN_TRIG_WAKEUP_PKT_8023_LEN = 0xd + NL80211_WOWLAN_TRIG_WAKEUP_TCP_CONNLOST = 0x10 + NL80211_WOWLAN_TRIG_WAKEUP_TCP_MATCH = 0xf + NL80211_WOWLAN_TRIG_WAKEUP_TCP_NOMORETOKENS = 0x11 + NL80211_WPA_VERSION_1 = 0x1 + NL80211_WPA_VERSION_2 = 0x2 + NL80211_WPA_VERSION_3 = 0x4 +) + +const ( + FRA_UNSPEC = 0x0 + FRA_DST = 0x1 + FRA_SRC = 0x2 + FRA_IIFNAME = 0x3 + FRA_GOTO = 0x4 + FRA_UNUSED2 = 0x5 + FRA_PRIORITY = 0x6 + FRA_UNUSED3 = 0x7 + FRA_UNUSED4 = 0x8 + FRA_UNUSED5 = 0x9 + FRA_FWMARK = 0xa + FRA_FLOW = 0xb + FRA_TUN_ID = 0xc + FRA_SUPPRESS_IFGROUP = 0xd + FRA_SUPPRESS_PREFIXLEN = 0xe + FRA_TABLE = 0xf + FRA_FWMASK = 0x10 + FRA_OIFNAME = 0x11 + FRA_PAD = 0x12 + FRA_L3MDEV = 0x13 + FRA_UID_RANGE = 0x14 + FRA_PROTOCOL = 0x15 + FRA_IP_PROTO = 0x16 + FRA_SPORT_RANGE = 0x17 + FRA_DPORT_RANGE = 0x18 + FR_ACT_UNSPEC = 0x0 + FR_ACT_TO_TBL = 0x1 + FR_ACT_GOTO = 0x2 + FR_ACT_NOP = 0x3 + FR_ACT_RES3 = 0x4 + FR_ACT_RES4 = 0x5 + FR_ACT_BLACKHOLE = 0x6 + FR_ACT_UNREACHABLE = 0x7 + FR_ACT_PROHIBIT = 0x8 +) + +const ( + AUDIT_NLGRP_NONE = 0x0 + AUDIT_NLGRP_READLOG = 0x1 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index bea25494..7551af48 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux @@ -240,6 +240,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -250,6 +254,13 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ [116]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -311,6 +322,15 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index b8c8f289..3e738ac0 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux @@ -255,6 +255,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -265,6 +269,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -324,6 +336,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 4db44301..6183eef4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux @@ -231,6 +231,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -241,6 +245,13 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ [116]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -302,6 +313,15 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 3ebcad8a..968cecb1 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux @@ -234,6 +234,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -244,6 +248,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -303,6 +315,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go new file mode 100644 index 00000000..8fe4c522 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -0,0 +1,685 @@ +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go +// Code generated by the command above; see README.md. DO NOT EDIT. + +//go:build loong64 && linux +// +build loong64,linux + +package unix + +const ( + SizeofPtr = 0x8 + SizeofLong = 0x8 +) + +type ( + _C_long int64 +) + +type Timespec struct { + Sec int64 + Nsec int64 +} + +type Timeval struct { + Sec int64 + Usec int64 +} + +type Timex struct { + Modes uint32 + Offset int64 + Freq int64 + Maxerror int64 + Esterror int64 + Status int32 + Constant int64 + Precision int64 + Tolerance int64 + Time Timeval + Tick int64 + Ppsfreq int64 + Jitter int64 + Shift int32 + Stabil int64 + Jitcnt int64 + Calcnt int64 + Errcnt int64 + Stbcnt int64 + Tai int32 + _ [44]byte +} + +type Time_t int64 + +type Tms struct { + Utime int64 + Stime int64 + Cutime int64 + Cstime int64 +} + +type Utimbuf struct { + Actime int64 + Modtime int64 +} + +type Rusage struct { + Utime Timeval + Stime Timeval + Maxrss int64 + Ixrss int64 + Idrss int64 + Isrss int64 + Minflt int64 + Majflt int64 + Nswap int64 + Inblock int64 + Oublock int64 + Msgsnd int64 + Msgrcv int64 + Nsignals int64 + Nvcsw int64 + Nivcsw int64 +} + +type Stat_t struct { + Dev uint64 + Ino uint64 + Mode uint32 + Nlink uint32 + Uid uint32 + Gid uint32 + Rdev uint64 + _ uint64 + Size int64 + Blksize int32 + _ int32 + Blocks int64 + Atim Timespec + Mtim Timespec + Ctim Timespec + _ [2]int32 +} + +type Dirent struct { + Ino uint64 + Off int64 + Reclen uint16 + Type uint8 + Name [256]int8 + _ [5]byte +} + +type Flock_t struct { + Type int16 + Whence int16 + Start int64 + Len int64 + Pid int32 + _ [4]byte +} + +type DmNameList struct { + Dev uint64 + Next uint32 + Name [0]byte + _ [4]byte +} + +const ( + FADV_DONTNEED = 0x4 + FADV_NOREUSE = 0x5 +) + +type RawSockaddrNFCLLCP struct { + Sa_family uint16 + Dev_idx uint32 + Target_idx uint32 + Nfc_protocol uint32 + Dsap uint8 + Ssap uint8 + Service_name [63]uint8 + Service_name_len uint64 +} + +type RawSockaddr struct { + Family uint16 + Data [14]int8 +} + +type RawSockaddrAny struct { + Addr RawSockaddr + Pad [96]int8 +} + +type Iovec struct { + Base *byte + Len uint64 +} + +type Msghdr struct { + Name *byte + Namelen uint32 + Iov *Iovec + Iovlen uint64 + Control *byte + Controllen uint64 + Flags int32 + _ [4]byte +} + +type Cmsghdr struct { + Len uint64 + Level int32 + Type int32 +} + +type ifreq struct { + Ifrn [16]byte + Ifru [24]byte +} + +const ( + SizeofSockaddrNFCLLCP = 0x60 + SizeofIovec = 0x10 + SizeofMsghdr = 0x38 + SizeofCmsghdr = 0x10 +) + +const ( + SizeofSockFprog = 0x10 +) + +type PtraceRegs struct { + Regs [32]uint64 + Orig_a0 uint64 + Era uint64 + Badv uint64 + Reserved [10]uint64 +} + +type FdSet struct { + Bits [16]int64 +} + +type Sysinfo_t struct { + Uptime int64 + Loads [3]uint64 + Totalram uint64 + Freeram uint64 + Sharedram uint64 + Bufferram uint64 + Totalswap uint64 + Freeswap uint64 + Procs uint16 + Pad uint16 + Totalhigh uint64 + Freehigh uint64 + Unit uint32 + _ [0]int8 + _ [4]byte +} + +type Ustat_t struct { + Tfree int32 + Tinode uint64 + Fname [6]int8 + Fpack [6]int8 + _ [4]byte +} + +type EpollEvent struct { + Events uint32 + _ int32 + Fd int32 + Pad int32 +} + +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + +const ( + POLLRDHUP = 0x2000 +) + +type Sigset_t struct { + Val [16]uint64 +} + +const _C__NSIG = 0x41 + +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + +type Termios struct { + Iflag uint32 + Oflag uint32 + Cflag uint32 + Lflag uint32 + Line uint8 + Cc [19]uint8 + Ispeed uint32 + Ospeed uint32 +} + +type Taskstats struct { + Version uint16 + Ac_exitcode uint32 + Ac_flag uint8 + Ac_nice uint8 + Cpu_count uint64 + Cpu_delay_total uint64 + Blkio_count uint64 + Blkio_delay_total uint64 + Swapin_count uint64 + Swapin_delay_total uint64 + Cpu_run_real_total uint64 + Cpu_run_virtual_total uint64 + Ac_comm [32]int8 + Ac_sched uint8 + Ac_pad [3]uint8 + _ [4]byte + Ac_uid uint32 + Ac_gid uint32 + Ac_pid uint32 + Ac_ppid uint32 + Ac_btime uint32 + Ac_etime uint64 + Ac_utime uint64 + Ac_stime uint64 + Ac_minflt uint64 + Ac_majflt uint64 + Coremem uint64 + Virtmem uint64 + Hiwater_rss uint64 + Hiwater_vm uint64 + Read_char uint64 + Write_char uint64 + Read_syscalls uint64 + Write_syscalls uint64 + Read_bytes uint64 + Write_bytes uint64 + Cancelled_write_bytes uint64 + Nvcsw uint64 + Nivcsw uint64 + Ac_utimescaled uint64 + Ac_stimescaled uint64 + Cpu_scaled_run_real_total uint64 + Freepages_count uint64 + Freepages_delay_total uint64 + Thrashing_count uint64 + Thrashing_delay_total uint64 + Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 +} + +type cpuMask uint64 + +const ( + _NCPUBITS = 0x40 +) + +const ( + CBitFieldMaskBit0 = 0x1 + CBitFieldMaskBit1 = 0x2 + CBitFieldMaskBit2 = 0x4 + CBitFieldMaskBit3 = 0x8 + CBitFieldMaskBit4 = 0x10 + CBitFieldMaskBit5 = 0x20 + CBitFieldMaskBit6 = 0x40 + CBitFieldMaskBit7 = 0x80 + CBitFieldMaskBit8 = 0x100 + CBitFieldMaskBit9 = 0x200 + CBitFieldMaskBit10 = 0x400 + CBitFieldMaskBit11 = 0x800 + CBitFieldMaskBit12 = 0x1000 + CBitFieldMaskBit13 = 0x2000 + CBitFieldMaskBit14 = 0x4000 + CBitFieldMaskBit15 = 0x8000 + CBitFieldMaskBit16 = 0x10000 + CBitFieldMaskBit17 = 0x20000 + CBitFieldMaskBit18 = 0x40000 + CBitFieldMaskBit19 = 0x80000 + CBitFieldMaskBit20 = 0x100000 + CBitFieldMaskBit21 = 0x200000 + CBitFieldMaskBit22 = 0x400000 + CBitFieldMaskBit23 = 0x800000 + CBitFieldMaskBit24 = 0x1000000 + CBitFieldMaskBit25 = 0x2000000 + CBitFieldMaskBit26 = 0x4000000 + CBitFieldMaskBit27 = 0x8000000 + CBitFieldMaskBit28 = 0x10000000 + CBitFieldMaskBit29 = 0x20000000 + CBitFieldMaskBit30 = 0x40000000 + CBitFieldMaskBit31 = 0x80000000 + CBitFieldMaskBit32 = 0x100000000 + CBitFieldMaskBit33 = 0x200000000 + CBitFieldMaskBit34 = 0x400000000 + CBitFieldMaskBit35 = 0x800000000 + CBitFieldMaskBit36 = 0x1000000000 + CBitFieldMaskBit37 = 0x2000000000 + CBitFieldMaskBit38 = 0x4000000000 + CBitFieldMaskBit39 = 0x8000000000 + CBitFieldMaskBit40 = 0x10000000000 + CBitFieldMaskBit41 = 0x20000000000 + CBitFieldMaskBit42 = 0x40000000000 + CBitFieldMaskBit43 = 0x80000000000 + CBitFieldMaskBit44 = 0x100000000000 + CBitFieldMaskBit45 = 0x200000000000 + CBitFieldMaskBit46 = 0x400000000000 + CBitFieldMaskBit47 = 0x800000000000 + CBitFieldMaskBit48 = 0x1000000000000 + CBitFieldMaskBit49 = 0x2000000000000 + CBitFieldMaskBit50 = 0x4000000000000 + CBitFieldMaskBit51 = 0x8000000000000 + CBitFieldMaskBit52 = 0x10000000000000 + CBitFieldMaskBit53 = 0x20000000000000 + CBitFieldMaskBit54 = 0x40000000000000 + CBitFieldMaskBit55 = 0x80000000000000 + CBitFieldMaskBit56 = 0x100000000000000 + CBitFieldMaskBit57 = 0x200000000000000 + CBitFieldMaskBit58 = 0x400000000000000 + CBitFieldMaskBit59 = 0x800000000000000 + CBitFieldMaskBit60 = 0x1000000000000000 + CBitFieldMaskBit61 = 0x2000000000000000 + CBitFieldMaskBit62 = 0x4000000000000000 + CBitFieldMaskBit63 = 0x8000000000000000 +) + +type SockaddrStorage struct { + Family uint16 + _ [118]int8 + _ uint64 +} + +type HDGeometry struct { + Heads uint8 + Sectors uint8 + Cylinders uint16 + Start uint64 +} + +type Statfs_t struct { + Type int64 + Bsize int64 + Blocks uint64 + Bfree uint64 + Bavail uint64 + Files uint64 + Ffree uint64 + Fsid Fsid + Namelen int64 + Frsize int64 + Flags int64 + Spare [4]int64 +} + +type TpacketHdr struct { + Status uint64 + Len uint32 + Snaplen uint32 + Mac uint16 + Net uint16 + Sec uint32 + Usec uint32 + _ [4]byte +} + +const ( + SizeofTpacketHdr = 0x20 +) + +type RTCPLLInfo struct { + Ctrl int32 + Value int32 + Max int32 + Min int32 + Posmult int32 + Negmult int32 + Clock int64 +} + +type BlkpgPartition struct { + Start int64 + Length int64 + Pno int32 + Devname [64]uint8 + Volname [64]uint8 + _ [4]byte +} + +const ( + BLKPG = 0x1269 +) + +type XDPUmemReg struct { + Addr uint64 + Len uint64 + Size uint32 + Headroom uint32 + Flags uint32 + _ [4]byte +} + +type CryptoUserAlg struct { + Name [64]int8 + Driver_name [64]int8 + Module_name [64]int8 + Type uint32 + Mask uint32 + Refcnt uint32 + Flags uint32 +} + +type CryptoStatAEAD struct { + Type [64]int8 + Encrypt_cnt uint64 + Encrypt_tlen uint64 + Decrypt_cnt uint64 + Decrypt_tlen uint64 + Err_cnt uint64 +} + +type CryptoStatAKCipher struct { + Type [64]int8 + Encrypt_cnt uint64 + Encrypt_tlen uint64 + Decrypt_cnt uint64 + Decrypt_tlen uint64 + Verify_cnt uint64 + Sign_cnt uint64 + Err_cnt uint64 +} + +type CryptoStatCipher struct { + Type [64]int8 + Encrypt_cnt uint64 + Encrypt_tlen uint64 + Decrypt_cnt uint64 + Decrypt_tlen uint64 + Err_cnt uint64 +} + +type CryptoStatCompress struct { + Type [64]int8 + Compress_cnt uint64 + Compress_tlen uint64 + Decompress_cnt uint64 + Decompress_tlen uint64 + Err_cnt uint64 +} + +type CryptoStatHash struct { + Type [64]int8 + Hash_cnt uint64 + Hash_tlen uint64 + Err_cnt uint64 +} + +type CryptoStatKPP struct { + Type [64]int8 + Setsecret_cnt uint64 + Generate_public_key_cnt uint64 + Compute_shared_secret_cnt uint64 + Err_cnt uint64 +} + +type CryptoStatRNG struct { + Type [64]int8 + Generate_cnt uint64 + Generate_tlen uint64 + Seed_cnt uint64 + Err_cnt uint64 +} + +type CryptoStatLarval struct { + Type [64]int8 +} + +type CryptoReportLarval struct { + Type [64]int8 +} + +type CryptoReportHash struct { + Type [64]int8 + Blocksize uint32 + Digestsize uint32 +} + +type CryptoReportCipher struct { + Type [64]int8 + Blocksize uint32 + Min_keysize uint32 + Max_keysize uint32 +} + +type CryptoReportBlkCipher struct { + Type [64]int8 + Geniv [64]int8 + Blocksize uint32 + Min_keysize uint32 + Max_keysize uint32 + Ivsize uint32 +} + +type CryptoReportAEAD struct { + Type [64]int8 + Geniv [64]int8 + Blocksize uint32 + Maxauthsize uint32 + Ivsize uint32 +} + +type CryptoReportComp struct { + Type [64]int8 +} + +type CryptoReportRNG struct { + Type [64]int8 + Seedsize uint32 +} + +type CryptoReportAKCipher struct { + Type [64]int8 +} + +type CryptoReportKPP struct { + Type [64]int8 +} + +type CryptoReportAcomp struct { + Type [64]int8 +} + +type LoopInfo struct { + Number int32 + Device uint32 + Inode uint64 + Rdevice uint32 + Offset int32 + Encrypt_type int32 + Encrypt_key_size int32 + Flags int32 + Name [64]int8 + Encrypt_key [32]uint8 + Init [2]uint64 + Reserved [4]int8 + _ [4]byte +} + +type TIPCSubscr struct { + Seq TIPCServiceRange + Timeout uint32 + Filter uint32 + Handle [8]int8 +} + +type TIPCSIOCLNReq struct { + Peer uint32 + Id uint32 + Linkname [68]int8 +} + +type TIPCSIOCNodeIDReq struct { + Peer uint32 + Id [16]int8 +} + +type PPSKInfo struct { + Assert_sequence uint32 + Clear_sequence uint32 + Assert_tu PPSKTime + Clear_tu PPSKTime + Current_mode int32 + _ [4]byte +} + +const ( + PPS_GETPARAMS = 0x800870a1 + PPS_SETPARAMS = 0x400870a2 + PPS_GETCAP = 0x800870a3 + PPS_FETCH = 0xc00870a4 +) + +const ( + PIDFD_NONBLOCK = 0x800 +) + +type SysvIpcPerm struct { + Key int32 + Uid uint32 + Gid uint32 + Cuid uint32 + Cgid uint32 + Mode uint32 + _ [0]uint8 + Seq uint16 + _ uint16 + _ uint64 + _ uint64 +} +type SysvShmDesc struct { + Perm SysvIpcPerm + Segsz uint64 + Atime int64 + Dtime int64 + Ctime int64 + Cpid int32 + Lpid int32 + Nattch uint64 + _ uint64 + _ uint64 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index 3eb33e48..11426a30 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux @@ -236,6 +236,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -246,6 +250,13 @@ type Sigset_t struct { const _C__NSIG = 0x80 +type Siginfo struct { + Signo int32 + Code int32 + Errno int32 + _ [116]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -307,6 +318,15 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 79a94467..ad1c3b3d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux @@ -237,6 +237,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -247,6 +251,14 @@ type Sigset_t struct { const _C__NSIG = 0x80 +type Siginfo struct { + Signo int32 + Code int32 + Errno int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -306,6 +318,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index 8f4b107c..15fd84e4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux @@ -237,6 +237,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -247,6 +251,14 @@ type Sigset_t struct { const _C__NSIG = 0x80 +type Siginfo struct { + Signo int32 + Code int32 + Errno int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -306,6 +318,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index e4eb2179..49c49825 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux @@ -236,6 +236,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -246,6 +250,13 @@ type Sigset_t struct { const _C__NSIG = 0x80 +type Siginfo struct { + Signo int32 + Code int32 + Errno int32 + _ [116]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -307,6 +318,15 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index d5b21f0f..cd36d0da 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux @@ -243,6 +243,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -253,6 +257,13 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ [116]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -314,6 +325,15 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 5188d142..8c6fce03 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux @@ -244,6 +244,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -254,6 +258,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -313,6 +325,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index de4dd4c7..20910f2a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux @@ -244,6 +244,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -254,6 +258,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -313,6 +325,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index dccbf9b0..71b7b333 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux @@ -262,6 +262,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -272,6 +276,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -331,6 +343,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index 63588061..71184cc2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux @@ -210,8 +210,8 @@ type PtraceFpregs struct { } type PtracePer struct { - _ [0]uint64 - _ [32]byte + Control_regs [3]uint64 + _ [8]byte Starting_addr uint64 Ending_addr uint64 Perc_atmid uint16 @@ -257,6 +257,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x80000 +) + const ( POLLRDHUP = 0x2000 ) @@ -267,6 +271,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -326,6 +338,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index 765edc13..06156285 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux @@ -239,6 +239,10 @@ type EpollEvent struct { Pad int32 } +const ( + OPEN_TREE_CLOEXEC = 0x400000 +) + const ( POLLRDHUP = 0x800 ) @@ -249,6 +253,14 @@ type Sigset_t struct { const _C__NSIG = 0x41 +type Siginfo struct { + Signo int32 + Errno int32 + Code int32 + _ int32 + _ [112]byte +} + type Termios struct { Iflag uint32 Oflag uint32 @@ -308,6 +320,14 @@ type Taskstats struct { Thrashing_count uint64 Thrashing_delay_total uint64 Ac_btime64 uint64 + Compact_count uint64 + Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go index baf5fe65..2ed718ca 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go @@ -94,10 +94,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte Pad_cgo_0 [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go index e21ae8ec..b4fb97eb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go @@ -96,10 +96,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go index f190651c..2c467504 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go @@ -98,10 +98,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go index 84747c58..ddee0451 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go @@ -94,10 +94,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go index ac5c8b63..eb13d4e8 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go @@ -94,10 +94,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index ad4aad27..c1a9b83a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -178,7 +178,7 @@ type Linger struct { } type Iovec struct { - Base *int8 + Base *byte Len uint64 } diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go index 855698bb..75980fd4 100644 --- a/vendor/golang.org/x/sys/windows/exec_windows.go +++ b/vendor/golang.org/x/sys/windows/exec_windows.go @@ -15,11 +15,11 @@ import ( // in http://msdn.microsoft.com/en-us/library/ms880421. // This function returns "" (2 double quotes) if s is empty. // Alternatively, these transformations are done: -// - every back slash (\) is doubled, but only if immediately -// followed by double quote ("); -// - every double quote (") is escaped by back slash (\); -// - finally, s is wrapped with double quotes (arg -> "arg"), -// but only if there is space or tab inside s. +// - every back slash (\) is doubled, but only if immediately +// followed by double quote ("); +// - every double quote (") is escaped by back slash (\); +// - finally, s is wrapped with double quotes (arg -> "arg"), +// but only if there is space or tab inside s. func EscapeArg(s string) string { if len(s) == 0 { return "\"\"" diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 200b62a0..be3ec2bd 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -10,6 +10,7 @@ import ( errorspkg "errors" "fmt" "runtime" + "strings" "sync" "syscall" "time" @@ -86,10 +87,8 @@ func StringToUTF16(s string) []uint16 { // s, with a terminating NUL added. If s contains a NUL byte at any // location, it returns (nil, syscall.EINVAL). func UTF16FromString(s string) ([]uint16, error) { - for i := 0; i < len(s); i++ { - if s[i] == 0 { - return nil, syscall.EINVAL - } + if strings.IndexByte(s, 0) != -1 { + return nil, syscall.EINVAL } return utf16.Encode([]rune(s + "\x00")), nil } @@ -186,8 +185,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys GetNamedPipeInfo(pipe Handle, flags *uint32, outSize *uint32, inSize *uint32, maxInstances *uint32) (err error) //sys GetNamedPipeHandleState(pipe Handle, state *uint32, curInstances *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32, userName *uint16, maxUserNameSize uint32) (err error) = GetNamedPipeHandleStateW //sys SetNamedPipeHandleState(pipe Handle, state *uint32, maxCollectionCount *uint32, collectDataTimeout *uint32) (err error) = SetNamedPipeHandleState -//sys ReadFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) -//sys WriteFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) +//sys readFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) = ReadFile +//sys writeFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) = WriteFile //sys GetOverlappedResult(handle Handle, overlapped *Overlapped, done *uint32, wait bool) (err error) //sys SetFilePointer(handle Handle, lowoffset int32, highoffsetptr *int32, whence uint32) (newlowoffset uint32, err error) [failretval==0xffffffff] //sys CloseHandle(handle Handle) (err error) @@ -363,6 +362,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys SetProcessWorkingSetSizeEx(hProcess Handle, dwMinimumWorkingSetSize uintptr, dwMaximumWorkingSetSize uintptr, flags uint32) (err error) //sys GetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) //sys SetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) +//sys GetActiveProcessorCount(groupNumber uint16) (ret uint32) +//sys GetMaximumProcessorCount(groupNumber uint16) (ret uint32) // Volume Management Functions //sys DefineDosDevice(flags uint32, deviceName *uint16, targetPath *uint16) (err error) = DefineDosDeviceW @@ -547,12 +548,6 @@ func Read(fd Handle, p []byte) (n int, err error) { } return 0, e } - if raceenabled { - if done > 0 { - raceWriteRange(unsafe.Pointer(&p[0]), int(done)) - } - raceAcquire(unsafe.Pointer(&ioSync)) - } return int(done), nil } @@ -565,12 +560,31 @@ func Write(fd Handle, p []byte) (n int, err error) { if e != nil { return 0, e } - if raceenabled && done > 0 { - raceReadRange(unsafe.Pointer(&p[0]), int(done)) - } return int(done), nil } +func ReadFile(fd Handle, p []byte, done *uint32, overlapped *Overlapped) error { + err := readFile(fd, p, done, overlapped) + if raceenabled { + if *done > 0 { + raceWriteRange(unsafe.Pointer(&p[0]), int(*done)) + } + raceAcquire(unsafe.Pointer(&ioSync)) + } + return err +} + +func WriteFile(fd Handle, p []byte, done *uint32, overlapped *Overlapped) error { + if raceenabled { + raceReleaseMerge(unsafe.Pointer(&ioSync)) + } + err := writeFile(fd, p, done, overlapped) + if raceenabled && *done > 0 { + raceReadRange(unsafe.Pointer(&p[0]), int(*done)) + } + return err +} + var ioSync int64 func Seek(fd Handle, offset int64, whence int) (newoffset int64, err error) { @@ -609,7 +623,6 @@ var ( func getStdHandle(stdhandle uint32) (fd Handle) { r, _ := GetStdHandle(stdhandle) - CloseOnExec(r) return r } @@ -848,6 +861,7 @@ const socket_error = uintptr(^uint32(0)) //sys GetAdaptersAddresses(family uint32, flags uint32, reserved uintptr, adapterAddresses *IpAdapterAddresses, sizePointer *uint32) (errcode error) = iphlpapi.GetAdaptersAddresses //sys GetACP() (acp uint32) = kernel32.GetACP //sys MultiByteToWideChar(codePage uint32, dwFlags uint32, str *byte, nstr int32, wchar *uint16, nwchar int32) (nwrite int32, err error) = kernel32.MultiByteToWideChar +//sys getBestInterfaceEx(sockaddr unsafe.Pointer, pdwBestIfIndex *uint32) (errcode error) = iphlpapi.GetBestInterfaceEx // For testing: clients can set this flag to force // creation of IPv6 sockets to return EAFNOSUPPORT. @@ -1032,6 +1046,14 @@ func Connect(fd Handle, sa Sockaddr) (err error) { return connect(fd, ptr, n) } +func GetBestInterfaceEx(sa Sockaddr, pdwBestIfIndex *uint32) (err error) { + ptr, _, err := sa.sockaddr() + if err != nil { + return err + } + return getBestInterfaceEx(ptr, pdwBestIfIndex) +} + func Getsockname(fd Handle) (sa Sockaddr, err error) { var rsa RawSockaddrAny l := int32(unsafe.Sizeof(rsa)) diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index bb31abda..f9eaca52 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -160,6 +160,10 @@ const ( MAX_COMPUTERNAME_LENGTH = 15 + MAX_DHCPV6_DUID_LENGTH = 130 + + MAX_DNS_SUFFIX_STRING_LENGTH = 256 + TIME_ZONE_ID_UNKNOWN = 0 TIME_ZONE_ID_STANDARD = 1 @@ -2000,27 +2004,62 @@ type IpAdapterPrefix struct { } type IpAdapterAddresses struct { - Length uint32 - IfIndex uint32 - Next *IpAdapterAddresses - AdapterName *byte - FirstUnicastAddress *IpAdapterUnicastAddress - FirstAnycastAddress *IpAdapterAnycastAddress - FirstMulticastAddress *IpAdapterMulticastAddress - FirstDnsServerAddress *IpAdapterDnsServerAdapter - DnsSuffix *uint16 - Description *uint16 - FriendlyName *uint16 - PhysicalAddress [syscall.MAX_ADAPTER_ADDRESS_LENGTH]byte - PhysicalAddressLength uint32 - Flags uint32 - Mtu uint32 - IfType uint32 - OperStatus uint32 - Ipv6IfIndex uint32 - ZoneIndices [16]uint32 - FirstPrefix *IpAdapterPrefix - /* more fields might be present here. */ + Length uint32 + IfIndex uint32 + Next *IpAdapterAddresses + AdapterName *byte + FirstUnicastAddress *IpAdapterUnicastAddress + FirstAnycastAddress *IpAdapterAnycastAddress + FirstMulticastAddress *IpAdapterMulticastAddress + FirstDnsServerAddress *IpAdapterDnsServerAdapter + DnsSuffix *uint16 + Description *uint16 + FriendlyName *uint16 + PhysicalAddress [syscall.MAX_ADAPTER_ADDRESS_LENGTH]byte + PhysicalAddressLength uint32 + Flags uint32 + Mtu uint32 + IfType uint32 + OperStatus uint32 + Ipv6IfIndex uint32 + ZoneIndices [16]uint32 + FirstPrefix *IpAdapterPrefix + TransmitLinkSpeed uint64 + ReceiveLinkSpeed uint64 + FirstWinsServerAddress *IpAdapterWinsServerAddress + FirstGatewayAddress *IpAdapterGatewayAddress + Ipv4Metric uint32 + Ipv6Metric uint32 + Luid uint64 + Dhcpv4Server SocketAddress + CompartmentId uint32 + NetworkGuid GUID + ConnectionType uint32 + TunnelType uint32 + Dhcpv6Server SocketAddress + Dhcpv6ClientDuid [MAX_DHCPV6_DUID_LENGTH]byte + Dhcpv6ClientDuidLength uint32 + Dhcpv6Iaid uint32 + FirstDnsSuffix *IpAdapterDNSSuffix +} + +type IpAdapterWinsServerAddress struct { + Length uint32 + Reserved uint32 + Next *IpAdapterWinsServerAddress + Address SocketAddress +} + +type IpAdapterGatewayAddress struct { + Length uint32 + Reserved uint32 + Next *IpAdapterGatewayAddress + Address SocketAddress +} + +type IpAdapterDNSSuffix struct { + Next *IpAdapterDNSSuffix + String [MAX_DNS_SUFFIX_STRING_LENGTH]uint16 } const ( @@ -3172,3 +3211,5 @@ type ModuleInfo struct { SizeOfImage uint32 EntryPoint uintptr } + +const ALL_PROCESSOR_GROUPS = 0xFFFF diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 1055d47e..678262cd 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -177,6 +177,7 @@ var ( procDnsRecordListFree = moddnsapi.NewProc("DnsRecordListFree") procGetAdaptersAddresses = modiphlpapi.NewProc("GetAdaptersAddresses") procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") + procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") procGetIfEntry = modiphlpapi.NewProc("GetIfEntry") procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") @@ -226,6 +227,7 @@ var ( procFreeLibrary = modkernel32.NewProc("FreeLibrary") procGenerateConsoleCtrlEvent = modkernel32.NewProc("GenerateConsoleCtrlEvent") procGetACP = modkernel32.NewProc("GetACP") + procGetActiveProcessorCount = modkernel32.NewProc("GetActiveProcessorCount") procGetCommTimeouts = modkernel32.NewProc("GetCommTimeouts") procGetCommandLineW = modkernel32.NewProc("GetCommandLineW") procGetComputerNameExW = modkernel32.NewProc("GetComputerNameExW") @@ -251,6 +253,7 @@ var ( procGetLogicalDriveStringsW = modkernel32.NewProc("GetLogicalDriveStringsW") procGetLogicalDrives = modkernel32.NewProc("GetLogicalDrives") procGetLongPathNameW = modkernel32.NewProc("GetLongPathNameW") + procGetMaximumProcessorCount = modkernel32.NewProc("GetMaximumProcessorCount") procGetModuleFileNameW = modkernel32.NewProc("GetModuleFileNameW") procGetModuleHandleExW = modkernel32.NewProc("GetModuleHandleExW") procGetNamedPipeHandleStateW = modkernel32.NewProc("GetNamedPipeHandleStateW") @@ -1537,6 +1540,14 @@ func GetAdaptersInfo(ai *IpAdapterInfo, ol *uint32) (errcode error) { return } +func getBestInterfaceEx(sockaddr unsafe.Pointer, pdwBestIfIndex *uint32) (errcode error) { + r0, _, _ := syscall.Syscall(procGetBestInterfaceEx.Addr(), 2, uintptr(sockaddr), uintptr(unsafe.Pointer(pdwBestIfIndex)), 0) + if r0 != 0 { + errcode = syscall.Errno(r0) + } + return +} + func GetIfEntry(pIfRow *MibIfRow) (errcode error) { r0, _, _ := syscall.Syscall(procGetIfEntry.Addr(), 1, uintptr(unsafe.Pointer(pIfRow)), 0, 0) if r0 != 0 { @@ -1967,6 +1978,12 @@ func GetACP() (acp uint32) { return } +func GetActiveProcessorCount(groupNumber uint16) (ret uint32) { + r0, _, _ := syscall.Syscall(procGetActiveProcessorCount.Addr(), 1, uintptr(groupNumber), 0, 0) + ret = uint32(r0) + return +} + func GetCommTimeouts(handle Handle, timeouts *CommTimeouts) (err error) { r1, _, e1 := syscall.Syscall(procGetCommTimeouts.Addr(), 2, uintptr(handle), uintptr(unsafe.Pointer(timeouts)), 0) if r1 == 0 { @@ -2169,6 +2186,12 @@ func GetLongPathName(path *uint16, buf *uint16, buflen uint32) (n uint32, err er return } +func GetMaximumProcessorCount(groupNumber uint16) (ret uint32) { + r0, _, _ := syscall.Syscall(procGetMaximumProcessorCount.Addr(), 1, uintptr(groupNumber), 0, 0) + ret = uint32(r0) + return +} + func GetModuleFileName(module Handle, filename *uint16, size uint32) (n uint32, err error) { r0, _, e1 := syscall.Syscall(procGetModuleFileNameW.Addr(), 3, uintptr(module), uintptr(unsafe.Pointer(filename)), uintptr(size)) n = uint32(r0) @@ -2747,7 +2770,7 @@ func ReadDirectoryChanges(handle Handle, buf *byte, buflen uint32, watchSubTree return } -func ReadFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) { +func readFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) { var _p0 *byte if len(buf) > 0 { _p0 = &buf[0] @@ -3189,7 +3212,7 @@ func WriteConsole(console Handle, buf *uint16, towrite uint32, written *uint32, return } -func WriteFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) { +func writeFile(handle Handle, buf []byte, done *uint32, overlapped *Overlapped) (err error) { var _p0 *byte if len(buf) > 0 { _p0 = &buf[0] diff --git a/vendor/golang.org/x/text/AUTHORS b/vendor/golang.org/x/text/AUTHORS deleted file mode 100644 index 15167cd7..00000000 --- a/vendor/golang.org/x/text/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/text/CONTRIBUTORS b/vendor/golang.org/x/text/CONTRIBUTORS deleted file mode 100644 index 1c4577e9..00000000 --- a/vendor/golang.org/x/text/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go new file mode 100644 index 00000000..752cdf03 --- /dev/null +++ b/vendor/golang.org/x/text/cases/cases.go @@ -0,0 +1,162 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go + +// Package cases provides general and language-specific case mappers. +package cases // import "golang.org/x/text/cases" + +import ( + "golang.org/x/text/language" + "golang.org/x/text/transform" +) + +// References: +// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. +// - https://www.unicode.org/reports/tr29/ +// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt +// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt +// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt +// - http://userguide.icu-project.org/transforms/casemappings + +// TODO: +// - Case folding +// - Wide and Narrow? +// - Segmenter option for title casing. +// - ASCII fast paths +// - Encode Soft-Dotted property within trie somehow. + +// A Caser transforms given input to a certain case. It implements +// transform.Transformer. +// +// A Caser may be stateful and should therefore not be shared between +// goroutines. +type Caser struct { + t transform.SpanningTransformer +} + +// Bytes returns a new byte slice with the result of converting b to the case +// form implemented by c. +func (c Caser) Bytes(b []byte) []byte { + b, _, _ = transform.Bytes(c.t, b) + return b +} + +// String returns a string with the result of transforming s to the case form +// implemented by c. +func (c Caser) String(s string) string { + s, _, _ = transform.String(c.t, s) + return s +} + +// Reset resets the Caser to be reused for new input after a previous call to +// Transform. +func (c Caser) Reset() { c.t.Reset() } + +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. +func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return c.t.Transform(dst, src, atEOF) +} + +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + +// Upper returns a Caser for language-specific uppercasing. +func Upper(t language.Tag, opts ...Option) Caser { + return Caser{makeUpper(t, getOpts(opts...))} +} + +// Lower returns a Caser for language-specific lowercasing. +func Lower(t language.Tag, opts ...Option) Caser { + return Caser{makeLower(t, getOpts(opts...))} +} + +// Title returns a Caser for language-specific title casing. It uses an +// approximation of the default Unicode Word Break algorithm. +func Title(t language.Tag, opts ...Option) Caser { + return Caser{makeTitle(t, getOpts(opts...))} +} + +// Fold returns a Caser that implements Unicode case folding. The returned Caser +// is stateless and safe to use concurrently by multiple goroutines. +// +// Case folding does not normalize the input and may not preserve a normal form. +// Use the collate or search package for more convenient and linguistically +// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons +// where security aspects are a concern. +func Fold(opts ...Option) Caser { + return Caser{makeFold(getOpts(opts...))} +} + +// An Option is used to modify the behavior of a Caser. +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. + +var ( + // NoLower disables the lowercasing of non-leading letters for a title + // caser. + NoLower Option = noLower + + // Compact omits mappings in case folding for characters that would grow the + // input. (Unimplemented.) + Compact Option = compact +) + +// TODO: option to preserve a normal form, if applicable? + +type options struct { + noLower bool + simple bool + + // TODO: segmenter, max ignorable, alternative versions, etc. + + ignoreFinalSigma bool +} + +func getOpts(o ...Option) (res options) { + for _, f := range o { + res = f(res) + } + return +} + +func noLower(o options) options { + o.noLower = true + return o +} + +func compact(o options) options { + o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o +} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go new file mode 100644 index 00000000..e9aa9e19 --- /dev/null +++ b/vendor/golang.org/x/text/cases/context.go @@ -0,0 +1,376 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +// A context is used for iterating over source bytes, fetching case info and +// writing to a destination buffer. +// +// Casing operations may need more than one rune of context to decide how a rune +// should be cased. Casing implementations should call checkpoint on context +// whenever it is known to be safe to return the runes processed so far. +// +// It is recommended for implementations to not allow for more than 30 case +// ignorables as lookahead (analogous to the limit in norm) and to use state if +// unbounded lookahead is needed for cased runes. +type context struct { + dst, src []byte + atEOF bool + + pDst int // pDst points past the last written rune in dst. + pSrc int // pSrc points to the start of the currently scanned rune. + + // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. + nDst, nSrc int + err error + + sz int // size of current rune + info info // case information of currently scanned rune + + // State preserved across calls to Transform. + isMidWord bool // false if next cased letter needs to be title-cased. +} + +func (c *context) Reset() { + c.isMidWord = false +} + +// ret returns the return values for the Transform method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) ret() (nDst, nSrc int, err error) { + if c.err != nil || c.nSrc == len(c.src) { + return c.nDst, c.nSrc, c.err + } + // This point is only reached by mappers if there was no short destination + // buffer. This means that the source buffer was exhausted and that c.sz was + // set to 0 by next. + if c.atEOF && c.pSrc == len(c.src) { + return c.pDst, c.pSrc, nil + } + return c.nDst, c.nSrc, transform.ErrShortSrc +} + +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + +// checkpoint sets the return value buffer points for Transform to the current +// positions. +func (c *context) checkpoint() { + if c.err == nil { + c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz + } +} + +// unreadRune causes the last rune read by next to be reread on the next +// invocation of next. Only one unreadRune may be called after a call to next. +func (c *context) unreadRune() { + c.sz = 0 +} + +func (c *context) next() bool { + c.pSrc += c.sz + if c.pSrc == len(c.src) || c.err != nil { + c.info, c.sz = 0, 0 + return false + } + v, sz := trie.lookup(c.src[c.pSrc:]) + c.info, c.sz = info(v), sz + if c.sz == 0 { + if c.atEOF { + // A zero size means we have an incomplete rune. If we are atEOF, + // this means it is an illegal rune, which we will consume one + // byte at a time. + c.sz = 1 + } else { + c.err = transform.ErrShortSrc + return false + } + } + return true +} + +// writeBytes adds bytes to dst. +func (c *context) writeBytes(b []byte) bool { + if len(c.dst)-c.pDst < len(b) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for _, ch := range b { + c.dst[c.pDst] = ch + c.pDst++ + } + return true +} + +// writeString writes the given string to dst. +func (c *context) writeString(s string) bool { + if len(c.dst)-c.pDst < len(s) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for i := 0; i < len(s); i++ { + c.dst[c.pDst] = s[i] + c.pDst++ + } + return true +} + +// copy writes the current rune to dst. +func (c *context) copy() bool { + return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) +} + +// copyXOR copies the current rune to dst and modifies it by applying the XOR +// pattern of the case info. It is the responsibility of the caller to ensure +// that this is a rune with a XOR pattern defined. +func (c *context) copyXOR() bool { + if !c.copy() { + return false + } + if c.info&xorIndexBit == 0 { + // Fast path for 6-bit XOR pattern, which covers most cases. + c.dst[c.pDst-1] ^= byte(c.info >> xorShift) + } else { + // Interpret XOR bits as an index. + // TODO: test performance for unrolling this loop. Verify that we have + // at least two bytes and at most three. + idx := c.info >> xorShift + for p := c.pDst - 1; ; p-- { + c.dst[p] ^= xorData[idx] + idx-- + if xorData[idx] == 0 { + break + } + } + } + return true +} + +// hasPrefix returns true if src[pSrc:] starts with the given string. +func (c *context) hasPrefix(s string) bool { + b := c.src[c.pSrc:] + if len(b) < len(s) { + return false + } + for i, c := range b[:len(s)] { + if c != s[i] { + return false + } + } + return true +} + +// caseType returns an info with only the case bits, normalized to either +// cLower, cUpper, cTitle or cUncased. +func (c *context) caseType() info { + cm := c.info & 0x7 + if cm < 4 { + return cm + } + if cm >= cXORCase { + // xor the last bit of the rune with the case type bits. + b := c.src[c.pSrc+c.sz-1] + return info(b&1) ^ cm&0x3 + } + if cm == cIgnorableCased { + return cLower + } + return cUncased +} + +// lower writes the lowercase version of the current rune to dst. +func lower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + return c.writeString(e[offset : offset+nLower]) + } + return c.copy() +} + +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// upper writes the uppercase version of the current rune to dst. +func upper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + // The first special case mapping is for lower. Set n to the second. + if n == noChange { + n = 0 + } + n, e = e[1]&lengthMask, e[n:] + } + if n != noChange { + return c.writeString(e[offset : offset+n]) + } + return c.copy() +} + +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// title writes the title case version of the current rune to dst. +func title(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return c.copy() + } + if c.info&exceptionBit == 0 { + if ct == cLower { + return c.copyXOR() + } + return c.copy() + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + + nFirst := (e[1] >> lengthBits) & lengthMask + if nTitle := e[1] & lengthMask; nTitle != noChange { + if nFirst != noChange { + e = e[nFirst:] + } + return c.writeString(e[offset : offset+nTitle]) + } + if ct == cLower && nFirst != noChange { + // Use the uppercase version instead. + return c.writeString(e[offset : offset+nFirst]) + } + // Already in correct case. + return c.copy() +} + +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// foldFull writes the foldFull version of the current rune to dst. +func foldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return c.copy() + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + return c.copyXOR() + } + return c.copy() + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 { + if ct == cLower { + return c.copy() + } + n = (e[1] >> lengthBits) & lengthMask + } + return c.writeString(e[2 : 2+n]) +} + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go new file mode 100644 index 00000000..85cc434f --- /dev/null +++ b/vendor/golang.org/x/text/cases/fold.go @@ -0,0 +1,34 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +type caseFolder struct{ transform.NopResetter } + +// caseFolder implements the Transformer interface for doing case folding. +func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + foldFull(&c) + c.checkpoint() + } + return c.ret() +} + +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { + // TODO: Special case folding, through option Language, Special/Turkic, or + // both. + // TODO: Implement Compact options. + return &caseFolder{} +} diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 00000000..2dc84b39 --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,62 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build icu +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include +#include +#include +#include +#include +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go new file mode 100644 index 00000000..87a7c3e9 --- /dev/null +++ b/vendor/golang.org/x/text/cases/info.go @@ -0,0 +1,82 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +func (c info) cccVal() info { + if c&exceptionBit != 0 { + return info(exceptions[c>>exceptionShift]) & cccMask + } + return c & cccMask +} + +func (c info) cccType() info { + ccc := c.cccVal() + if ccc <= cccZero { + return cccZero + } + return ccc +} + +// TODO: Implement full Unicode breaking algorithm: +// 1) Implement breaking in separate package. +// 2) Use the breaker here. +// 3) Compare table size and performance of using the more generic breaker. +// +// Note that we can extend the current algorithm to be much more accurate. This +// only makes sense, though, if the performance and/or space penalty of using +// the generic breaker is big. Extra data will only be needed for non-cased +// runes, which means there are sufficient bits left in the caseType. +// ICU prohibits breaking in such cases as well. + +// For the purpose of title casing we use an approximation of the Unicode Word +// Breaking algorithm defined in Annex #29: +// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. +// +// For our approximation, we group the Word Break types into the following +// categories, with associated rules: +// +// 1) Letter: +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. +// Rule: Never break between consecutive runes of this category. +// +// 2) Mid: +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). +// Rule: Don't break between Letter and Mid, but break between two Mids. +// +// 3) Break: +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. +// Rule: Always break. +// +// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in +// preventing a break between two cased letters. For now we will ignore this +// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and +// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) +// +// Note 2: the rule for Mid is very approximate, but works in most cases. To +// improve, we could store the categories in the trie value and use a FA to +// manage breaks. See TODO comment above. +// +// Note 3: according to the spec, it is possible for the Extend category to +// introduce breaks between other categories grouped in Letter. However, this +// is undesirable for our purposes. ICU prevents breaks in such cases as well. + +// isBreak returns whether this rune should introduce a break. +func (c info) isBreak() bool { + return c.cccVal() == cccBreak +} + +// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, +// Numeric, ExtendNumLet, or Extend. +func (c info) isLetter() bool { + ccc := c.cccVal() + if ccc == cccZero { + return !c.isCaseIgnorable() + } + return ccc != cccBreak +} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go new file mode 100644 index 00000000..0f7c6a14 --- /dev/null +++ b/vendor/golang.org/x/text/cases/map.go @@ -0,0 +1,816 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +// This file contains the definitions of case mappings for all supported +// languages. The rules for the language-specific tailorings were taken and +// modified from the CLDR transform definitions in common/transforms. + +import ( + "strings" + "unicode" + "unicode/utf8" + + "golang.org/x/text/internal" + "golang.org/x/text/language" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +// A mapFunc takes a context set to the current rune and writes the mapped +// version to the same context. It may advance the context to the next rune. It +// returns whether a checkpoint is possible: whether the pDst bytes written to +// dst so far won't need changing as we see more source bytes. +type mapFunc func(*context) bool + +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + +// maxIgnorable defines the maximum number of ignorables to consider for +// lookahead operations. +const maxIgnorable = 30 + +// supported lists the language tags for which we have tailorings. +const supported = "und af az el lt nl tr" + +func init() { + tags := []language.Tag{} + for _, s := range strings.Split(supported, " ") { + tags = append(tags, language.MustParse(s)) + } + matcher = internal.NewInheritanceMatcher(tags) + Supported = language.NewCoverage(tags) +} + +var ( + matcher *internal.InheritanceMatcher + + Supported language.Coverage + + // We keep the following lists separate, instead of having a single per- + // language struct, to give the compiler a chance to remove unused code. + + // Some uppercase mappers are stateless, so we can precompute the + // Transformers and save a bit on runtime allocations. + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr + } + + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} + + lowerFunc = []mapFunc{ + nil, // und + nil, // af + aztrLower, // az + nil, // el + ltLower, // lt + nil, // nl + aztrLower, // tr + } + + titleInfos = []struct { + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) + }{ + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr + } +) + +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := upperFunc[i].upper + if f == nil { + return undUpper + } + return &simpleCaser{f: f, span: upperFunc[i].span} +} + +func makeLower(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := lowerFunc[i] + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} + } + return &lowerCaser{ + first: f, + midWord: finalSigma(f), + } +} + +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + x := &titleInfos[i] + lower := x.lower + if o.noLower { + lower = (*context).copy + } else if !o.ignoreFinalSigma { + lower = finalSigma(lower) + } + return &titleCaser{ + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, + } +} + +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + +// TODO: consider a similar special case for the fast majority lower case. This +// is a bit more involved so will require some more precise benchmarking to +// justify it. + +type undUpperCaser struct{ transform.NopResetter } + +// undUpperCaser implements the Transformer interface for doing an upper case +// mapping for the root locale (und). It eliminates the need for an allocation +// as it prevents escaping by not using function pointers. +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + upper(&c) + c.checkpoint() + } + return c.ret() +} + +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +type simpleCaser struct { + context + f mapFunc + span spanFunc +} + +// simpleCaser implements the Transformer interface for doing a case operation +// on a rune-by-rune basis. +func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { + c.checkpoint() + } + return c.ret() +} + +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// lowerCaser implements the Transformer interface. The default Unicode lower +// casing requires different treatment for the first and subsequent characters +// of a word, most notably to handle the Greek final Sigma. +type lowerCaser struct { + undLowerIgnoreSigmaCaser + + context + + first, midWord mapFunc +} + +func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF} + c := &t.context + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !t.first(c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !t.midWord(c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +// titleCaser implements the Transformer interface. Title casing algorithms +// distinguish between the first letter of a word and subsequent letters of the +// same word. It uses state to avoid requiring a potentially infinite lookahead. +type titleCaser struct { + context + + // rune mappings used by the actual casing algorithms. + title mapFunc + lower mapFunc + titleSpan spanFunc + + rewrite func(*context) +} + +// Transform implements the standard Unicode title case algorithm as defined in +// Chapter 3 of The Unicode Standard: +// toTitlecase(X): Find the word boundaries in X according to Unicode Standard +// Annex #29, "Unicode Text Segmentation." For each word boundary, find the +// first cased character F following the word boundary. If F exists, map F to +// Titlecase_Mapping(F); then map all characters C between F and the following +// word boundary to Lowercase_Mapping(C). +func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.ret() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.title(c) { + break + } + c.isMidWord = true + } else if !t.lower(c) { + break + } + } else if !c.copy() { + break + } else if p.isBreak() { + c.isMidWord = false + } + + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.ret() +} + +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.retSpan() +} + +// finalSigma adds Greek final Sigma handing to another casing function. It +// determines whether a lowercased sigma should be σ or ς, by looking ahead for +// case-ignorables and a cased letters. +func finalSigma(f mapFunc) mapFunc { + return func(c *context) bool { + if !c.hasPrefix("Σ") { + return f(c) + } + return finalSigmaBody(c) + } +} + +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ + } + c.unreadRune() + return true + } + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() + } + return true +} + +// finalSigmaSpan would be the same as isLower. + +// elUpper implements Greek upper casing, which entails removing a predefined +// set of non-blocked modifiers. Note that these accents should not be removed +// for title casing! +// Example: "Οδός" -> "ΟΔΟΣ". +func elUpper(c *context) bool { + // From CLDR: + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; + + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !upper(c) { + return false + } + if !unicode.Is(unicode.Greek, r) { + return true + } + i := 0 + // Take the properties of the uppercased rune that is already written to the + // destination. This saves us the trouble of having to uppercase the + // decomposed rune again. + if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { + // Restore the destination position and process the decomposed rune. + r, sz := utf8.DecodeRune(b) + if r <= 0xFF { // See A.6.1 + return true + } + c.pDst = oldPDst + // Insert the first rune and ignore the modifiers. See A.6.2. + c.writeBytes(b[:sz]) + i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. + } + + for ; i < maxIgnorable && c.next(); i++ { + switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { + // Above and Iota Subscript + case 0x0300, // U+0300 COMBINING GRAVE ACCENT + 0x0301, // U+0301 COMBINING ACUTE ACCENT + 0x0304, // U+0304 COMBINING MACRON + 0x0306, // U+0306 COMBINING BREVE + 0x0308, // U+0308 COMBINING DIAERESIS + 0x0313, // U+0313 COMBINING COMMA ABOVE + 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE + 0x0342, // U+0342 COMBINING GREEK PERISPOMENI + 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI + // No-op. Gobble the modifier. + + default: + switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { + case cccZero: + c.unreadRune() + return true + + // We don't need to test for IotaSubscript as the only rune that + // qualifies (U+0345) was already excluded in the switch statement + // above. See A.4. + + case cccAbove: + return c.copy() + default: + // Some other modifier. We're still allowed to gobble Greek + // modifiers after this. + c.copy() + } + } + } + return i == maxIgnorable +} + +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + +func ltLower(c *context) bool { + // From CLDR: + // # Introduce an explicit dot above when lowercasing capital I's and J's + // # whenever there are more accents above. + // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) + // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I + // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J + // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK + // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE + // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE + // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE + // ::NFD(); + // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; + // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; + // ::Any-Lower(); + // ::NFC(); + + i := 0 + if r := c.src[c.pSrc]; r < utf8.RuneSelf { + lower(c) + if r != 'I' && r != 'J' { + return true + } + } else { + p := norm.NFD.Properties(c.src[c.pSrc:]) + if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { + // UTF-8 optimization: the decomposition will only have an above + // modifier if the last rune of the decomposition is in [U+300-U+311]. + // In all other cases, a decomposition starting with I is always + // an I followed by modifiers that are not cased themselves. See A.2. + if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. + if !c.writeBytes(d[:1]) { + return false + } + c.dst[c.pDst-1] += 'a' - 'A' // lower + + // Assumption: modifier never changes on lowercase. See A.1. + // Assumption: all modifiers added have CCC = Above. See A.2.3. + return c.writeString("\u0307") && c.writeBytes(d[1:]) + } + // In all other cases the additional modifiers will have a CCC + // that is less than 230 (Above). We will insert the U+0307, if + // needed, after these modifiers so that a string in FCD form + // will remain so. See A.2.2. + lower(c) + i = 1 + } else { + return lower(c) + } + } + + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + return c.writeString("\u0307") && c.copy() // See A.1. + default: + c.copy() // See A.1. + } + } + return i == maxIgnorable +} + +// ltLowerSpan would be the same as isLower. + +func ltUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // + // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. + // ::NFD(); + // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; + // ::Any-Upper(); + // ::NFC(); + + // TODO: See A.5. A soft-dotted rune never has an exception. This would + // allow us to overload the exception bit and encode this property in + // info. Need to measure performance impact of this. + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !f(c) { + return false + } + if !unicode.Is(unicode.Soft_Dotted, r) { + return true + } + + // We don't need to do an NFD normalization, as a soft-dotted rune never + // contains U+0307. See A.3. + + i := 0 + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + if c.hasPrefix("\u0307") { + // We don't do a full NFC, but rather combine runes for + // some of the common cases. (Returning NFC or + // preserving normal form is neither a requirement nor + // a possibility anyway). + if !c.next() { + return false + } + if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { + s := "" + switch c.src[c.pSrc+1] { + case 0x80: // U+0300 COMBINING GRAVE ACCENT + s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE + case 0x81: // U+0301 COMBINING ACUTE ACCENT + s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE + case 0x83: // U+0303 COMBINING TILDE + s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE + case 0x88: // U+0308 COMBINING DIAERESIS + s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS + default: + } + if s != "" { + c.pDst = oldPDst + return c.writeString(s) + } + } + } + return c.copy() + default: + c.copy() + } + } + return i == maxIgnorable + } +} + +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + +func aztrUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // i→İ; + if c.src[c.pSrc] == 'i' { + return c.writeString("İ") + } + return f(c) + } +} + +func aztrLower(c *context) (done bool) { + // From CLDR: + // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri + // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE + // İ→i; + // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. + // # This matches the behavior of the canonically equivalent I-dot_above + // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE + // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. + // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I + // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; + // I→ı ; + // ::Any-Lower(); + if c.hasPrefix("\u0130") { // İ + return c.writeString("i") + } + if c.src[c.pSrc] != 'I' { + return lower(c) + } + + // We ignore the lower-case I for now, but insert it later when we know + // which form we need. + start := c.pSrc + c.sz + + i := 0 +Loop: + // We check for up to n ignorables before \u0307. As \u0307 is an + // ignorable as well, n is maxIgnorable-1. + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccAbove: + if c.hasPrefix("\u0307") { + return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 + } + done = true + break Loop + case cccZero: + c.unreadRune() + done = true + break Loop + default: + // We'll write this rune after we know which starter to use. + } + } + if i == maxIgnorable { + done = true + } + return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done +} + +// aztrLowerSpan would be the same as isLower. + +func nlTitle(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { + return title(c) + } + + if !c.writeString("I") || !c.next() { + return false + } + if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { + return c.writeString("J") + } + c.unreadRune() + return true +} + +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + +// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078. +func afnlRewrite(c *context) { + if c.hasPrefix("'") || c.hasPrefix("’") { + c.isMidWord = true + } +} diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go new file mode 100644 index 00000000..ca992310 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables10.0.0.go @@ -0,0 +1,2256 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.10 && !go1.13 +// +build go1.10,!go1.13 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11892 bytes (11.61 KiB). Checksum: c6f15484b7653775. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0014, 0x40a: 0x0014, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x368: 0xed, 0x369: 0xee, 0x36a: 0xef, 0x36b: 0xf0, + 0x370: 0xf1, 0x371: 0xf2, 0x372: 0xf3, 0x374: 0xf4, 0x375: 0xf5, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf6, + 0x390: 0x23, 0x391: 0xf7, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf8, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf7, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf9, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xf0, 0x469: 0xfa, 0x46b: 0xfb, 0x46c: 0xfc, 0x46d: 0xfd, 0x46e: 0xfe, + 0x47c: 0x23, 0x47d: 0xff, 0x47e: 0x100, 0x47f: 0x101, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0x102, 0x4b2: 0x103, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x104, 0x4c6: 0x105, + 0x4c9: 0x106, + 0x4d0: 0x107, 0x4d1: 0x108, 0x4d2: 0x109, 0x4d3: 0x10a, 0x4d4: 0x10b, 0x4d5: 0x10c, 0x4d6: 0x10d, 0x4d7: 0x10e, + 0x4d8: 0x10f, 0x4d9: 0x110, 0x4da: 0x111, 0x4db: 0x112, 0x4dc: 0x113, 0x4dd: 0x114, 0x4de: 0x115, 0x4df: 0x116, + 0x4e8: 0x117, 0x4e9: 0x118, 0x4ea: 0x119, + // Block 0x14, offset 0x500 + 0x500: 0x11a, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x11b, 0x524: 0x10, 0x525: 0x11c, + 0x538: 0x11d, 0x539: 0x11, 0x53a: 0x11e, + // Block 0x15, offset 0x540 + 0x544: 0x11f, 0x545: 0x120, 0x546: 0x121, + 0x54f: 0x122, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x123, 0x5c1: 0x124, 0x5c4: 0x124, 0x5c5: 0x124, 0x5c6: 0x124, 0x5c7: 0x125, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 277 entries, 554 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x54, 0x64, 0x6b, 0x70, 0x7e, 0x7f, 0x8d, 0x9c, 0xa6, 0xa9, 0xaf, 0xb7, 0xba, 0xbc, 0xca, 0xd0, 0xde, 0xe9, 0xf5, 0x100, 0x10c, 0x116, 0x122, 0x12d, 0x139, 0x145, 0x14d, 0x155, 0x15f, 0x16a, 0x176, 0x17d, 0x188, 0x18d, 0x195, 0x198, 0x19d, 0x1a1, 0x1a5, 0x1ac, 0x1b5, 0x1bd, 0x1be, 0x1c7, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e7, 0x1eb, 0x1ee, 0x1f0, 0x1f3, 0x1f8, 0x1f9, 0x1fb, 0x1fd, 0x1ff, 0x206, 0x20b, 0x20f, 0x218, 0x21b, 0x21e, 0x224, 0x225, 0x230, 0x231, 0x232, 0x237, 0x244, 0x24c, 0x254, 0x25d, 0x266, 0x26f, 0x274, 0x277, 0x280, 0x28d, 0x28f, 0x296, 0x298, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x326, 0x32d, 0x331, 0x33a, 0x33b, 0x343, 0x347, 0x34c, 0x354, 0x35a, 0x360, 0x36a, 0x36f, 0x378, 0x37e, 0x385, 0x389, 0x391, 0x393, 0x395, 0x398, 0x39a, 0x39c, 0x39d, 0x39e, 0x3a0, 0x3a2, 0x3a8, 0x3ad, 0x3af, 0x3b5, 0x3b8, 0x3ba, 0x3c0, 0x3c5, 0x3c7, 0x3c8, 0x3c9, 0x3ca, 0x3cc, 0x3ce, 0x3d0, 0x3d3, 0x3d5, 0x3d8, 0x3e0, 0x3e3, 0x3e7, 0x3ef, 0x3f1, 0x3f2, 0x3f3, 0x3f5, 0x3fb, 0x3fd, 0x3fe, 0x400, 0x402, 0x404, 0x411, 0x412, 0x413, 0x417, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x421, 0x425, 0x42b, 0x42d, 0x434, 0x437, 0x43b, 0x441, 0x44a, 0x450, 0x456, 0x460, 0x46a, 0x46c, 0x473, 0x479, 0x47f, 0x485, 0x488, 0x48e, 0x491, 0x499, 0x49a, 0x4a1, 0x4a2, 0x4a5, 0x4af, 0x4b5, 0x4bb, 0x4bc, 0x4c2, 0x4c5, 0x4cd, 0x4d4, 0x4db, 0x4dc, 0x4dd, 0x4de, 0x4df, 0x4e1, 0x4e3, 0x4e5, 0x4e9, 0x4ea, 0x4ec, 0x4ed, 0x4ee, 0x4f0, 0x4f5, 0x4fa, 0x4fe, 0x4ff, 0x502, 0x506, 0x511, 0x515, 0x51d, 0x522, 0x526, 0x529, 0x52d, 0x530, 0x533, 0x538, 0x53c, 0x540, 0x544, 0x548, 0x54a, 0x54c, 0x54f, 0x554, 0x556, 0x55b, 0x564, 0x569, 0x56a, 0x56d, 0x56e, 0x56f, 0x571, 0x572, 0x573} + +// sparseValues: 1395 entries, 5580 bytes +var sparseValues = [1395]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x54 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x64 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x6b + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x7e + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x7f + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8d + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0x9c + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xa6 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xa9 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xb7 + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x19, offset 0xba + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xbc + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xca + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xe9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x1f, offset 0xf5 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x100 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10c + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x116 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x23, offset 0x122 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x139 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x155 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x15f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16a + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x176 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x188 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a1 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1bd + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1ce + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d6 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f3 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f8 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1f9 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fb + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fd + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x1ff + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20b + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x218 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21e + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x230 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x231 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x232 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x237 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x244 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24c + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x254 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x26f + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x274 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x277 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x280 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x296 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xae}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33a + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x343 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x347 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34c + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x354 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35a + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x360 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36a + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x36f + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x378 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37e + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x385 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x391 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39a + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39d + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39e + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a2 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a8 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ad + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3af + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b5 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b8 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3ba + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3c9 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3ce + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa7, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e0 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e7 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f5 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fb + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fd + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x404 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x411 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x412 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41b + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41c + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42b + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42d + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x437 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43b + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x441 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x460 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46a + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x473 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x479 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x47f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x485 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48e + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x499 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49a + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a1 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a2 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xdc, offset 0x4af + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + // Block 0xde, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdf, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe1, offset 0x4c5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe2, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4d4 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe4, offset 0x4db + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe6, offset 0x4dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe7, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe8, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe9, offset 0x4e1 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xea, offset 0x4e3 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xeb, offset 0x4e5 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xec, offset 0x4e9 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xed, offset 0x4ea + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xee, offset 0x4ec + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xef, offset 0x4ed + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf0, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf1, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf2, offset 0x4f5 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf3, offset 0x4fa + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf4, offset 0x4fe + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf5, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf6, offset 0x502 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf7, offset 0x506 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf9, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xfa, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xfb, offset 0x522 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xfc, offset 0x526 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xfd, offset 0x529 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xfe, offset 0x52d + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xff, offset 0x530 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x533 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x101, offset 0x538 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x102, offset 0x53c + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x103, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x104, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x105, offset 0x548 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x106, offset 0x54a + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x107, offset 0x54c + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x108, offset 0x54f + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x109, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10a, offset 0x556 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x10b, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x10c, offset 0x564 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x10d, offset 0x569 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x56a + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10f, offset 0x56d + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x110, offset 0x56e + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x111, offset 0x56f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x112, offset 0x571 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x113, offset 0x572 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14177 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go new file mode 100644 index 00000000..b1106b41 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables11.0.0.go @@ -0,0 +1,2317 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.13 && !go1.14 +// +build go1.13,!go1.14 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "11.0.0" + +var xorData string = "" + // Size: 188 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a" + + "\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&" + + "\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00" + + "\x01\x22" + +var exceptions string = "" + // Size: 2436 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ" + + "\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი" + + "\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ" + + "\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ" + + "\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ" + + "\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ" + + "\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ" + + "\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12сСС\x12\x12" + + "тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗ" + + "T̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14" + + "$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ" + + "\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈ" + + "Ι\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15" + + "\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ" + + "\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ" + + "\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠι" + + "ὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧι" + + "ὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ" + + "\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ" + + "\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ" + + "\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΙ" + + "̈́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓" + + "\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x16" + + "6ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽ" + + "ɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ" + + "\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ" + + "\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl" + + "\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄ" + + "ն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12250 bytes (11.96 KiB). Checksum: 53ff6cb7321675e1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x198a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1a6a, 0x2d1: 0x1aea, + 0x2d2: 0x1b6a, 0x2d3: 0x1bea, 0x2d4: 0x1c6a, 0x2d5: 0x1cea, 0x2d6: 0x1d6a, 0x2d7: 0x1dea, + 0x2d8: 0x1e6a, 0x2d9: 0x1eea, 0x2da: 0x1f6a, 0x2db: 0x1fea, 0x2dc: 0x206a, 0x2dd: 0x20ea, + 0x2de: 0x216a, 0x2df: 0x21ea, 0x2e0: 0x226a, 0x2e1: 0x22ea, 0x2e2: 0x236a, 0x2e3: 0x23ea, + 0x2e4: 0x246a, 0x2e5: 0x24ea, 0x2e6: 0x256a, 0x2e7: 0x25ea, 0x2e8: 0x266a, 0x2e9: 0x26ea, + 0x2ea: 0x276a, 0x2eb: 0x27ea, 0x2ec: 0x286a, 0x2ed: 0x28ea, 0x2ee: 0x296a, 0x2ef: 0x29ea, + 0x2f0: 0x2a6a, 0x2f1: 0x2aea, 0x2f2: 0x2b6a, 0x2f3: 0x2bea, 0x2f4: 0x2c6a, 0x2f5: 0x2cea, + 0x2f6: 0x2d6a, 0x2f7: 0x2dea, 0x2f8: 0x2e6a, 0x2f9: 0x2eea, 0x2fa: 0x2f6a, + 0x2fc: 0x0014, 0x2fd: 0x2fea, 0x2fe: 0x306a, 0x2ff: 0x30ea, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3a9a, 0x311: 0x0812, + 0x312: 0x3b7a, 0x313: 0x0812, 0x314: 0x3cba, 0x315: 0x0812, 0x316: 0x3dfa, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x8e52, 0x331: 0x8e52, 0x332: 0x9152, 0x333: 0x9152, 0x334: 0x9452, 0x335: 0x9452, + 0x336: 0x9752, 0x337: 0x9752, 0x338: 0x9a52, 0x339: 0x9a52, 0x33a: 0x9d52, 0x33b: 0x9d52, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3f3a, 0x341: 0x402a, 0x342: 0x411a, 0x343: 0x420a, 0x344: 0x42fa, 0x345: 0x43ea, + 0x346: 0x44da, 0x347: 0x45ca, 0x348: 0x46b9, 0x349: 0x47a9, 0x34a: 0x4899, 0x34b: 0x4989, + 0x34c: 0x4a79, 0x34d: 0x4b69, 0x34e: 0x4c59, 0x34f: 0x4d49, 0x350: 0x4e3a, 0x351: 0x4f2a, + 0x352: 0x501a, 0x353: 0x510a, 0x354: 0x51fa, 0x355: 0x52ea, 0x356: 0x53da, 0x357: 0x54ca, + 0x358: 0x55b9, 0x359: 0x56a9, 0x35a: 0x5799, 0x35b: 0x5889, 0x35c: 0x5979, 0x35d: 0x5a69, + 0x35e: 0x5b59, 0x35f: 0x5c49, 0x360: 0x5d3a, 0x361: 0x5e2a, 0x362: 0x5f1a, 0x363: 0x600a, + 0x364: 0x60fa, 0x365: 0x61ea, 0x366: 0x62da, 0x367: 0x63ca, 0x368: 0x64b9, 0x369: 0x65a9, + 0x36a: 0x6699, 0x36b: 0x6789, 0x36c: 0x6879, 0x36d: 0x6969, 0x36e: 0x6a59, 0x36f: 0x6b49, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6c3a, 0x373: 0x6d4a, 0x374: 0x6e1a, + 0x376: 0x6efa, 0x377: 0x6fda, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x8e53, 0x37b: 0x8e53, + 0x37c: 0x7119, 0x37d: 0x0004, 0x37e: 0x71ea, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x726a, 0x383: 0x737a, 0x384: 0x744a, + 0x386: 0x752a, 0x387: 0x760a, 0x388: 0x9153, 0x389: 0x9153, 0x38a: 0x9453, 0x38b: 0x9453, + 0x38c: 0x7749, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x781a, 0x393: 0x795a, 0x396: 0x7a9a, 0x397: 0x7b7a, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9753, 0x39b: 0x9753, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7cba, 0x3a3: 0x7dfa, + 0x3a4: 0x7f3a, 0x3a5: 0x0912, 0x3a6: 0x801a, 0x3a7: 0x80fa, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0x9d53, 0x3ab: 0x9d53, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x823a, 0x3b3: 0x834a, 0x3b4: 0x841a, + 0x3b6: 0x84fa, 0x3b7: 0x85da, 0x3b8: 0x9a53, 0x3b9: 0x9a53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8719, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x87eb, 0x3e8: 0x0013, + 0x3ea: 0x884b, 0x3eb: 0x888b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa053, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa352, 0x411: 0xa352, + 0x412: 0xa652, 0x413: 0xa652, 0x414: 0xa952, 0x415: 0xa952, 0x416: 0xa652, 0x417: 0xa652, + 0x418: 0xa352, 0x419: 0xa352, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xac52, 0x451: 0xac52, + 0x452: 0xac52, 0x453: 0xac52, 0x454: 0xac52, 0x455: 0xac52, 0x456: 0xac52, 0x457: 0xac52, + 0x458: 0xac52, 0x459: 0xac52, 0x45a: 0xac52, 0x45b: 0xac52, 0x45c: 0xac52, 0x45d: 0xac52, + 0x45e: 0xac52, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x88eb, 0x463: 0x8b53, + 0x464: 0x894b, 0x465: 0x89aa, 0x466: 0x8a0a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8a6b, 0x46e: 0x8acb, 0x46f: 0x8b2b, + 0x470: 0x8b8b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8beb, 0x47f: 0x8c4b, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8cab, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x0012, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d0b, 0x4ab: 0x8d6b, 0x4ac: 0x8dcb, 0x4ad: 0x8e2b, 0x4ae: 0x8e8b, 0x4af: 0x0012, + 0x4b0: 0x8eeb, 0x4b1: 0x8f4b, 0x4b2: 0x8fab, 0x4b3: 0xaf53, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x900a, 0x4c1: 0x908a, 0x4c2: 0x910a, 0x4c3: 0x918a, 0x4c4: 0x923a, 0x4c5: 0x92ea, + 0x4c6: 0x936a, + 0x4d3: 0x93ea, 0x4d4: 0x94ca, 0x4d5: 0x95aa, 0x4d6: 0x968a, 0x4d7: 0x976a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xb853, 0x51f: 0xb853, 0x520: 0xbb53, 0x521: 0xbb53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, + // Block 0xd, offset 0x340 + 0x340: 0xd6, 0x341: 0xd7, 0x342: 0xd8, 0x343: 0xd9, 0x344: 0xda, 0x345: 0xdb, 0x346: 0xdc, 0x347: 0xdd, + 0x348: 0xde, 0x34a: 0xdf, 0x34b: 0xe0, 0x34c: 0xe1, 0x34d: 0xe2, + 0x350: 0xe3, 0x351: 0xe4, 0x352: 0xe5, 0x353: 0xe6, 0x356: 0xe7, 0x357: 0xe8, + 0x358: 0xe9, 0x359: 0xea, 0x35a: 0xeb, 0x35b: 0xec, 0x35c: 0xed, + 0x360: 0xee, 0x362: 0xef, 0x363: 0xf0, + 0x368: 0xf1, 0x369: 0xf2, 0x36a: 0xf3, 0x36b: 0xf4, + 0x370: 0xf5, 0x371: 0xf6, 0x372: 0xf7, 0x374: 0xf8, 0x375: 0xf9, 0x376: 0xfa, + 0x37b: 0xfb, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xfc, + 0x390: 0x24, 0x391: 0xfd, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0xfe, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0xfd, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0xff, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf4, 0x469: 0x100, 0x46b: 0x101, 0x46c: 0x102, 0x46d: 0x103, 0x46e: 0x104, + 0x479: 0x105, 0x47c: 0x24, 0x47d: 0x106, 0x47e: 0x107, 0x47f: 0x108, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x109, 0x4b2: 0x10a, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c9: 0x10d, + 0x4d0: 0x10e, 0x4d1: 0x10f, 0x4d2: 0x110, 0x4d3: 0x111, 0x4d4: 0x112, 0x4d5: 0x113, 0x4d6: 0x114, 0x4d7: 0x115, + 0x4d8: 0x116, 0x4d9: 0x117, 0x4da: 0x118, 0x4db: 0x119, 0x4dc: 0x11a, 0x4dd: 0x11b, 0x4de: 0x11c, 0x4df: 0x11d, + 0x4e8: 0x11e, 0x4e9: 0x11f, 0x4ea: 0x120, + // Block 0x14, offset 0x500 + 0x500: 0x121, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x122, 0x524: 0x12, 0x525: 0x123, + 0x538: 0x124, 0x539: 0x13, 0x53a: 0x125, + // Block 0x15, offset 0x540 + 0x544: 0x126, 0x545: 0x127, 0x546: 0x128, + 0x54f: 0x129, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x12a, 0x5c1: 0x12b, 0x5c4: 0x12b, 0x5c5: 0x12b, 0x5c6: 0x12b, 0x5c7: 0x12c, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 282 entries, 564 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x280, 0x282, 0x289, 0x28b, 0x297, 0x298, 0x2a3, 0x2ab, 0x2b3, 0x2b9, 0x2ba, 0x2c8, 0x2cd, 0x2d0, 0x2d5, 0x2d9, 0x2df, 0x2e4, 0x2e7, 0x2ec, 0x2f1, 0x2f2, 0x2f8, 0x2fa, 0x2fb, 0x2fd, 0x2ff, 0x302, 0x303, 0x305, 0x308, 0x30e, 0x312, 0x314, 0x319, 0x320, 0x324, 0x32d, 0x32e, 0x337, 0x33b, 0x340, 0x348, 0x34e, 0x354, 0x35e, 0x363, 0x36c, 0x372, 0x379, 0x37d, 0x385, 0x387, 0x389, 0x38c, 0x38e, 0x390, 0x391, 0x392, 0x394, 0x396, 0x39c, 0x3a1, 0x3a3, 0x3a9, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3bc, 0x3bd, 0x3be, 0x3c0, 0x3c2, 0x3c4, 0x3c7, 0x3c9, 0x3cc, 0x3d4, 0x3d7, 0x3db, 0x3e3, 0x3e5, 0x3e6, 0x3e7, 0x3e9, 0x3ef, 0x3f1, 0x3f2, 0x3f4, 0x3f6, 0x3f8, 0x405, 0x406, 0x407, 0x40b, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x414, 0x417, 0x41d, 0x421, 0x425, 0x42b, 0x42e, 0x435, 0x439, 0x43d, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x477, 0x47d, 0x483, 0x489, 0x48c, 0x492, 0x495, 0x49d, 0x49e, 0x4a5, 0x4a9, 0x4aa, 0x4ad, 0x4b5, 0x4bb, 0x4c2, 0x4c3, 0x4c9, 0x4cc, 0x4d4, 0x4db, 0x4e5, 0x4ed, 0x4f0, 0x4f1, 0x4f2, 0x4f3, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fe, 0x4ff, 0x501, 0x503, 0x504, 0x505, 0x507, 0x50c, 0x511, 0x515, 0x516, 0x519, 0x51d, 0x528, 0x52c, 0x534, 0x539, 0x53d, 0x540, 0x544, 0x547, 0x54a, 0x54f, 0x553, 0x557, 0x55b, 0x55f, 0x561, 0x563, 0x566, 0x56b, 0x56d, 0x572, 0x57b, 0x580, 0x581, 0x584, 0x585, 0x586, 0x588, 0x589, 0x58a} + +// sparseValues: 1418 entries, 5672 bytes +var sparseValues = [1418]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x316a, lo: 0x80, hi: 0x80}, + {value: 0x31ea, lo: 0x81, hi: 0x81}, + {value: 0x326a, lo: 0x82, hi: 0x82}, + {value: 0x32ea, lo: 0x83, hi: 0x83}, + {value: 0x336a, lo: 0x84, hi: 0x84}, + {value: 0x33ea, lo: 0x85, hi: 0x85}, + {value: 0x346a, lo: 0x86, hi: 0x86}, + {value: 0x34ea, lo: 0x87, hi: 0x87}, + {value: 0x356a, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5a, offset 0x280 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x282 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x289 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28b + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x361a, lo: 0x96, hi: 0x96}, + {value: 0x36ca, lo: 0x97, hi: 0x97}, + {value: 0x377a, lo: 0x98, hi: 0x98}, + {value: 0x382a, lo: 0x99, hi: 0x99}, + {value: 0x38da, lo: 0x9a, hi: 0x9a}, + {value: 0x398a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3a3b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a3 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ab + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2ba + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2c8 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa052, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2cd + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d0 + {value: 0xa353, lo: 0xb6, hi: 0xb7}, + {value: 0xa653, lo: 0xb8, hi: 0xb9}, + {value: 0xa953, lo: 0xba, hi: 0xbb}, + {value: 0xa653, lo: 0xbc, hi: 0xbd}, + {value: 0xa353, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d5 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xac53, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2d9 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2df + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ec + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f1 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f2 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2f8 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fa + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fb + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x2fd + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x2ff + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x303 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x308 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x314 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x319 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x320 + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x324 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x32e + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x337 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x340 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x34e + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x354 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x35e + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x363 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x36c + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x372 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xaf52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x379 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x385 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x387 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x38e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x391 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x396 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x39c + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3a3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3a9 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3ac + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3ae + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3b9 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3bb + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3bd + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3be + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3c2 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3cc + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb253, lo: 0x98, hi: 0x9f}, + {value: 0xb553, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3d4 + {value: 0xb252, lo: 0x80, hi: 0x87}, + {value: 0xb552, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3d7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb553, lo: 0xb0, hi: 0xb7}, + {value: 0xb253, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3db + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb552, lo: 0x98, hi: 0x9f}, + {value: 0xb252, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3e5 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3e6 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3e7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3e9 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3f2 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x405 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x406 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x40b + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x40d + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x40f + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x410 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc3, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc4, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc5, offset 0x42b + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc6, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc7, offset 0x435 + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc8, offset 0x439 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x43d + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xca, offset 0x444 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcc, offset 0x453 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcd, offset 0x459 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xce, offset 0x463 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd0, offset 0x46f + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + // Block 0xd1, offset 0x477 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x47d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd3, offset 0x483 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd4, offset 0x489 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd5, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x492 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x495 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd8, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd9, offset 0x49e + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xda, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdb, offset 0x4a9 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdc, offset 0x4aa + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xde, offset 0x4b5 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdf, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe1, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4c9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe3, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe4, offset 0x4d4 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4db + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4e5 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe7, offset 0x4ed + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xe8, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe9, offset 0x4f1 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xea, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xeb, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xec, offset 0x4f4 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xed, offset 0x4f6 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xee, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xef, offset 0x4fa + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf0, offset 0x4fe + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf1, offset 0x4ff + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf2, offset 0x501 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xf3, offset 0x503 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf4, offset 0x504 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf5, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf6, offset 0x507 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf7, offset 0x50c + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf9, offset 0x515 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfa, offset 0x516 + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xfb, offset 0x519 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfc, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xfd, offset 0x528 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xfe, offset 0x52c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xff, offset 0x534 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x100, offset 0x539 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x101, offset 0x53d + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x102, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x103, offset 0x544 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x104, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x105, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x106, offset 0x54f + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x107, offset 0x553 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x557 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x109, offset 0x55b + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10a, offset 0x55f + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10b, offset 0x561 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x10c, offset 0x563 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x10d, offset 0x566 + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x10e, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10f, offset 0x56d + {value: 0xb852, lo: 0x80, hi: 0x81}, + {value: 0xbb52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x110, offset 0x572 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x111, offset 0x57b + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x112, offset 0x580 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x113, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x584 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x115, offset 0x585 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x116, offset 0x586 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x117, offset 0x588 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x118, offset 0x589 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14906 bytes (14KiB); checksum: 362795C7 diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go new file mode 100644 index 00000000..ae7dc240 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables12.0.0.go @@ -0,0 +1,2360 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.14 && !go1.16 +// +build go1.14,!go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "12.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12396 bytes (12.11 KiB). Checksum: c0656238384c3da1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, 0x33f: 0xd6, + // Block 0xd, offset 0x340 + 0x340: 0xd7, 0x341: 0xd8, 0x342: 0xd9, 0x343: 0xda, 0x344: 0xdb, 0x345: 0xdc, 0x346: 0xdd, 0x347: 0xde, + 0x348: 0xdf, 0x34a: 0xe0, 0x34b: 0xe1, 0x34c: 0xe2, 0x34d: 0xe3, + 0x350: 0xe4, 0x351: 0xe5, 0x352: 0xe6, 0x353: 0xe7, 0x356: 0xe8, 0x357: 0xe9, + 0x358: 0xea, 0x359: 0xeb, 0x35a: 0xec, 0x35b: 0xed, 0x35c: 0xee, + 0x360: 0xef, 0x362: 0xf0, 0x363: 0xf1, 0x366: 0xf2, 0x367: 0xf3, + 0x368: 0xf4, 0x369: 0xf5, 0x36a: 0xf6, 0x36b: 0xf7, + 0x370: 0xf8, 0x371: 0xf9, 0x372: 0xfa, 0x374: 0xfb, 0x375: 0xfc, 0x376: 0xfd, + 0x37b: 0xfe, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xff, + 0x390: 0x24, 0x391: 0x100, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x101, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x102, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x103, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf7, 0x469: 0x104, 0x46b: 0x105, 0x46c: 0x106, 0x46d: 0x107, 0x46e: 0x108, + 0x479: 0x109, 0x47c: 0x24, 0x47d: 0x10a, 0x47e: 0x10b, 0x47f: 0x10c, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x10d, 0x4b2: 0x10e, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10f, 0x4c6: 0x110, + 0x4c9: 0x111, + 0x4d0: 0x112, 0x4d1: 0x113, 0x4d2: 0x114, 0x4d3: 0x115, 0x4d4: 0x116, 0x4d5: 0x117, 0x4d6: 0x118, 0x4d7: 0x119, + 0x4d8: 0x11a, 0x4d9: 0x11b, 0x4da: 0x11c, 0x4db: 0x11d, 0x4dc: 0x11e, 0x4dd: 0x11f, 0x4de: 0x120, 0x4df: 0x121, + 0x4e8: 0x122, 0x4e9: 0x123, 0x4ea: 0x124, + // Block 0x14, offset 0x500 + 0x500: 0x125, 0x504: 0x126, 0x505: 0x127, + 0x50b: 0x128, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x129, 0x524: 0x12, 0x525: 0x12a, + 0x538: 0x12b, 0x539: 0x13, 0x53a: 0x12c, + // Block 0x15, offset 0x540 + 0x544: 0x12d, 0x545: 0x12e, 0x546: 0x12f, + 0x54f: 0x130, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x131, 0x5c1: 0x132, 0x5c4: 0x132, 0x5c5: 0x132, 0x5c6: 0x132, 0x5c7: 0x133, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 289 entries, 578 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x281, 0x283, 0x28a, 0x28e, 0x29a, 0x29b, 0x2a6, 0x2ae, 0x2b6, 0x2bc, 0x2bd, 0x2cb, 0x2d0, 0x2d3, 0x2d8, 0x2dc, 0x2e2, 0x2e7, 0x2ea, 0x2ef, 0x2f4, 0x2f5, 0x2fb, 0x2fd, 0x2fe, 0x300, 0x302, 0x305, 0x306, 0x308, 0x30b, 0x311, 0x315, 0x317, 0x31c, 0x323, 0x32b, 0x334, 0x335, 0x33e, 0x342, 0x347, 0x34f, 0x355, 0x35b, 0x365, 0x36a, 0x373, 0x379, 0x380, 0x384, 0x38c, 0x38e, 0x390, 0x393, 0x395, 0x397, 0x398, 0x399, 0x39b, 0x39d, 0x3a3, 0x3a8, 0x3aa, 0x3b1, 0x3b4, 0x3b6, 0x3bc, 0x3c1, 0x3c3, 0x3c4, 0x3c5, 0x3c6, 0x3c8, 0x3ca, 0x3cc, 0x3cf, 0x3d1, 0x3d4, 0x3dc, 0x3df, 0x3e3, 0x3eb, 0x3ed, 0x3ee, 0x3ef, 0x3f1, 0x3f7, 0x3f9, 0x3fa, 0x3fc, 0x3fe, 0x400, 0x40d, 0x40e, 0x40f, 0x413, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41c, 0x41f, 0x425, 0x426, 0x42a, 0x42e, 0x434, 0x437, 0x43e, 0x442, 0x446, 0x44d, 0x456, 0x45c, 0x462, 0x46c, 0x476, 0x478, 0x481, 0x487, 0x48d, 0x493, 0x496, 0x49c, 0x49f, 0x4a8, 0x4a9, 0x4b0, 0x4b4, 0x4b5, 0x4b8, 0x4ba, 0x4c1, 0x4c9, 0x4cf, 0x4d5, 0x4d6, 0x4dc, 0x4df, 0x4e7, 0x4ee, 0x4f8, 0x500, 0x503, 0x504, 0x505, 0x506, 0x508, 0x509, 0x50b, 0x50d, 0x50f, 0x513, 0x514, 0x516, 0x519, 0x51b, 0x51d, 0x51f, 0x524, 0x529, 0x52d, 0x52e, 0x531, 0x535, 0x540, 0x544, 0x54c, 0x551, 0x555, 0x558, 0x55c, 0x55f, 0x562, 0x567, 0x56b, 0x56f, 0x573, 0x577, 0x579, 0x57b, 0x57e, 0x583, 0x586, 0x588, 0x58b, 0x58d, 0x593, 0x59c, 0x5a1, 0x5a2, 0x5a5, 0x5a6, 0x5a7, 0x5a9, 0x5aa, 0x5ab} + +// sparseValues: 1451 entries, 5804 bytes +var sparseValues = [1451]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x281 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x283 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28a + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28e + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29a + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a6 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ae + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bc + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2bd + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cb + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d0 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d3 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d8 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dc + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e2 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ef + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f5 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fb + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fd + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fe + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x300 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x306 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30b + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x311 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x315 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x317 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x323 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x32b + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x335 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x342 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x347 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x34f + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x355 + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x365 + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x36a + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x373 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x379 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa7}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x384 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x395 + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x398 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x39b + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x39d + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3a3 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a8 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3aa + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b1 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3b4 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3b6 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3c3 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3c5 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3d4 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3dc + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3df + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e3 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3ed + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3ee + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3fa + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x40d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x40f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x415 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x416 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x417 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x418 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x425 + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc3, offset 0x426 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc4, offset 0x42a + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc5, offset 0x42e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc6, offset 0x434 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc7, offset 0x437 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc8, offset 0x43e + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xca, offset 0x446 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcc, offset 0x456 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcd, offset 0x45c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xce, offset 0x462 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd0, offset 0x476 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd1, offset 0x478 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0x9f}, + // Block 0xd2, offset 0x481 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x487 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd4, offset 0x48d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x493 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd6, offset 0x496 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd7, offset 0x49c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd8, offset 0x49f + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xd9, offset 0x4a8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xda, offset 0x4a9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xdb, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdc, offset 0x4b4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xde, offset 0x4b8 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xdf, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe0, offset 0x4c1 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe1, offset 0x4c9 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe2, offset 0x4cf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe4, offset 0x4d6 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe6, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe7, offset 0x4e7 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe8, offset 0x4ee + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe9, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xea, offset 0x500 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xeb, offset 0x503 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xed, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xee, offset 0x506 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xef, offset 0x508 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf0, offset 0x509 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x50b + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf2, offset 0x50d + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf3, offset 0x50f + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf4, offset 0x513 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf5, offset 0x514 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf6, offset 0x516 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xf7, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf8, offset 0x51b + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa3}, + // Block 0xf9, offset 0x51d + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xfa, offset 0x51f + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xfb, offset 0x524 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xfc, offset 0x529 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xfd, offset 0x52d + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfe, offset 0x52e + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xff, offset 0x531 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x535 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x102, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x103, offset 0x54c + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x104, offset 0x551 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x105, offset 0x555 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x106, offset 0x558 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x107, offset 0x55c + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x55f + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x109, offset 0x562 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x10a, offset 0x567 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x10b, offset 0x56b + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x10c, offset 0x56f + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x10d, offset 0x573 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10e, offset 0x577 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10f, offset 0x579 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x110, offset 0x57b + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x111, offset 0x57e + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x112, offset 0x583 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x113, offset 0x586 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x114, offset 0x588 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x115, offset 0x58b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x116, offset 0x58d + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x117, offset 0x593 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x118, offset 0x59c + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x119, offset 0x5a1 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11a, offset 0x5a2 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11b, offset 0x5a5 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x11c, offset 0x5a6 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11d, offset 0x5a7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x5a9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x11f, offset 0x5aa + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15070 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go new file mode 100644 index 00000000..cd874775 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -0,0 +1,2400 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.16 +// +build go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "13.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12538 bytes (12.24 KiB). Checksum: af4dfa7d60c71d4c. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16b: 0x66, 0x16c: 0x67, 0x16d: 0x68, 0x16e: 0x69, 0x16f: 0x6a, + 0x170: 0x6b, 0x171: 0x6c, 0x172: 0x6d, 0x173: 0x6e, 0x174: 0x6f, 0x175: 0x70, 0x176: 0x71, 0x177: 0x72, + 0x178: 0x73, 0x179: 0x73, 0x17a: 0x74, 0x17b: 0x73, 0x17c: 0x75, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x76, 0x181: 0x77, 0x182: 0x78, 0x183: 0x79, 0x184: 0x0d, 0x185: 0x7a, 0x186: 0x7b, + 0x192: 0x7c, 0x193: 0x0e, + 0x1b0: 0x7d, 0x1b1: 0x0f, 0x1b2: 0x73, 0x1b3: 0x7e, 0x1b4: 0x7f, 0x1b5: 0x80, 0x1b6: 0x81, 0x1b7: 0x82, + 0x1b8: 0x83, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x84, 0x1c2: 0x85, 0x1c3: 0x86, 0x1c4: 0x87, 0x1c5: 0x24, 0x1c6: 0x88, + // Block 0x8, offset 0x200 + 0x200: 0x89, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x8a, 0x213: 0x8b, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8c, 0x219: 0x8d, 0x21a: 0x8e, 0x21b: 0x8f, 0x21c: 0x90, 0x21d: 0x91, 0x21e: 0x10, 0x21f: 0x92, + 0x220: 0x93, 0x221: 0x94, 0x222: 0x24, 0x223: 0x95, 0x224: 0x96, 0x225: 0x97, 0x226: 0x98, 0x227: 0x99, + 0x228: 0x9a, 0x229: 0x9b, 0x22a: 0x9c, 0x22b: 0x9d, 0x22c: 0x9e, 0x22d: 0x9f, 0x22e: 0xa0, 0x22f: 0xa1, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa2, 0x29f: 0xa3, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa4, 0x2ee: 0xa5, 0x2ef: 0xa6, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa7, 0x2f5: 0xa8, 0x2f6: 0xa9, 0x2f7: 0xaa, + 0x2f8: 0xab, 0x2f9: 0xac, 0x2fa: 0x24, 0x2fb: 0xad, 0x2fc: 0xae, 0x2fd: 0xaf, 0x2fe: 0xb0, 0x2ff: 0xb1, + // Block 0xc, offset 0x300 + 0x300: 0xb2, 0x301: 0xb3, 0x302: 0x24, 0x303: 0xb4, 0x305: 0xb5, 0x307: 0xb6, + 0x30a: 0xb7, 0x30b: 0xb8, 0x30c: 0xb9, 0x30d: 0xba, 0x30e: 0xbb, 0x30f: 0xbc, + 0x310: 0xbd, 0x311: 0xbe, 0x312: 0xbf, 0x313: 0xc0, 0x314: 0xc1, 0x315: 0xc2, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc3, 0x31d: 0xc4, + 0x320: 0xc5, 0x321: 0xc6, 0x322: 0xc7, 0x323: 0xc8, 0x324: 0xc9, 0x326: 0xca, + 0x328: 0xcb, 0x329: 0xcc, 0x32a: 0xcd, 0x32b: 0xce, 0x32c: 0x5f, 0x32d: 0xcf, 0x32e: 0xd0, + 0x330: 0x24, 0x331: 0xd1, 0x332: 0xd2, 0x333: 0xd3, 0x334: 0xd4, + 0x33a: 0xd5, 0x33c: 0xd6, 0x33d: 0xd7, 0x33e: 0xd8, 0x33f: 0xd9, + // Block 0xd, offset 0x340 + 0x340: 0xda, 0x341: 0xdb, 0x342: 0xdc, 0x343: 0xdd, 0x344: 0xde, 0x345: 0xdf, 0x346: 0xe0, 0x347: 0xe1, + 0x348: 0xe2, 0x34a: 0xe3, 0x34b: 0xe4, 0x34c: 0xe5, 0x34d: 0xe6, + 0x350: 0xe7, 0x351: 0xe8, 0x352: 0xe9, 0x353: 0xea, 0x356: 0xeb, 0x357: 0xec, + 0x358: 0xed, 0x359: 0xee, 0x35a: 0xef, 0x35b: 0xf0, 0x35c: 0xf1, + 0x360: 0xf2, 0x362: 0xf3, 0x363: 0xf4, 0x364: 0xf5, 0x365: 0xf6, 0x366: 0xf7, 0x367: 0xf8, + 0x368: 0xf9, 0x369: 0xfa, 0x36a: 0xfb, 0x36b: 0xfc, + 0x370: 0xfd, 0x371: 0xfe, 0x372: 0xff, 0x374: 0x100, 0x375: 0x101, 0x376: 0x102, + 0x37b: 0x103, 0x37e: 0x104, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0x105, + 0x390: 0x24, 0x391: 0x106, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x107, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x108, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x109, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xfc, 0x469: 0x10a, 0x46b: 0x10b, 0x46c: 0x10c, 0x46d: 0x10d, 0x46e: 0x10e, + 0x479: 0x10f, 0x47c: 0x24, 0x47d: 0x110, 0x47e: 0x111, 0x47f: 0x112, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x113, 0x4b2: 0x114, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x115, 0x4c6: 0x116, + 0x4c9: 0x117, + 0x4d0: 0x118, 0x4d1: 0x119, 0x4d2: 0x11a, 0x4d3: 0x11b, 0x4d4: 0x11c, 0x4d5: 0x11d, 0x4d6: 0x11e, 0x4d7: 0x11f, + 0x4d8: 0x120, 0x4d9: 0x121, 0x4da: 0x122, 0x4db: 0x123, 0x4dc: 0x124, 0x4dd: 0x125, 0x4de: 0x126, 0x4df: 0x127, + 0x4e8: 0x128, 0x4e9: 0x129, 0x4ea: 0x12a, + // Block 0x14, offset 0x500 + 0x500: 0x12b, 0x504: 0x12c, 0x505: 0x12d, + 0x50b: 0x12e, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x12f, 0x524: 0x12, 0x525: 0x130, + 0x538: 0x131, 0x539: 0x13, 0x53a: 0x132, + // Block 0x15, offset 0x540 + 0x544: 0x133, 0x545: 0x134, 0x546: 0x135, + 0x54f: 0x136, + 0x56f: 0x137, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x138, 0x5c1: 0x139, 0x5c4: 0x139, 0x5c5: 0x139, 0x5c6: 0x139, 0x5c7: 0x13a, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 296 entries, 592 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xc0, 0xc6, 0xd4, 0xdf, 0xec, 0xf7, 0x103, 0x10d, 0x119, 0x124, 0x130, 0x13c, 0x144, 0x14d, 0x157, 0x162, 0x16e, 0x174, 0x17f, 0x185, 0x18d, 0x190, 0x195, 0x199, 0x19d, 0x1a4, 0x1ad, 0x1b5, 0x1b6, 0x1bf, 0x1c6, 0x1ce, 0x1d4, 0x1d9, 0x1dd, 0x1e0, 0x1e2, 0x1e5, 0x1ea, 0x1eb, 0x1ed, 0x1ef, 0x1f1, 0x1f8, 0x1fd, 0x201, 0x20a, 0x20d, 0x210, 0x216, 0x217, 0x222, 0x223, 0x224, 0x229, 0x236, 0x23f, 0x240, 0x248, 0x251, 0x25a, 0x263, 0x268, 0x26b, 0x276, 0x284, 0x286, 0x28d, 0x291, 0x29d, 0x29e, 0x2a9, 0x2b1, 0x2b9, 0x2bf, 0x2c0, 0x2ce, 0x2d3, 0x2d6, 0x2db, 0x2df, 0x2e5, 0x2ea, 0x2ed, 0x2f2, 0x2f7, 0x2f8, 0x2fe, 0x300, 0x301, 0x303, 0x305, 0x308, 0x309, 0x30b, 0x30e, 0x314, 0x318, 0x31a, 0x31f, 0x326, 0x331, 0x33b, 0x33c, 0x345, 0x349, 0x34e, 0x356, 0x35c, 0x362, 0x36c, 0x371, 0x37a, 0x380, 0x389, 0x38d, 0x395, 0x397, 0x399, 0x39c, 0x39e, 0x3a0, 0x3a1, 0x3a2, 0x3a4, 0x3a6, 0x3ac, 0x3b1, 0x3b3, 0x3ba, 0x3bd, 0x3bf, 0x3c5, 0x3ca, 0x3cc, 0x3cd, 0x3ce, 0x3cf, 0x3d1, 0x3d3, 0x3d5, 0x3d8, 0x3da, 0x3dd, 0x3e5, 0x3e8, 0x3ec, 0x3f4, 0x3f6, 0x3f7, 0x3f8, 0x3fa, 0x400, 0x402, 0x403, 0x405, 0x407, 0x409, 0x416, 0x417, 0x418, 0x41c, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x425, 0x428, 0x42b, 0x431, 0x432, 0x434, 0x438, 0x43c, 0x442, 0x445, 0x44c, 0x450, 0x454, 0x45d, 0x466, 0x46c, 0x472, 0x47c, 0x486, 0x488, 0x491, 0x497, 0x49d, 0x4a3, 0x4a6, 0x4ac, 0x4af, 0x4b8, 0x4b9, 0x4c0, 0x4c4, 0x4c5, 0x4c8, 0x4d2, 0x4d5, 0x4d7, 0x4de, 0x4e6, 0x4ec, 0x4f2, 0x4f3, 0x4f9, 0x4fc, 0x504, 0x50b, 0x515, 0x51d, 0x520, 0x521, 0x522, 0x523, 0x524, 0x526, 0x527, 0x529, 0x52b, 0x52d, 0x531, 0x532, 0x534, 0x537, 0x539, 0x53c, 0x53e, 0x543, 0x548, 0x54c, 0x54d, 0x550, 0x554, 0x55f, 0x563, 0x56b, 0x570, 0x574, 0x577, 0x57b, 0x57e, 0x581, 0x586, 0x58a, 0x58e, 0x592, 0x596, 0x598, 0x59a, 0x59d, 0x5a2, 0x5a5, 0x5a7, 0x5aa, 0x5ac, 0x5b2, 0x5bb, 0x5c0, 0x5c1, 0x5c4, 0x5c5, 0x5c6, 0x5c7, 0x5c9, 0x5ca, 0x5cb} + +// sparseValues: 1483 entries, 5932 bytes +var sparseValues = [1483]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x19, offset 0xb0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xc0 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xdf + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xec + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x103 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x124 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x130 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x144 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x157 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x162 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x185 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x190 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b6 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c6 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1ce + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d4 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1e0 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e5 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1ea + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ed + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f8 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fd + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x201 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x20a + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20d + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x217 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x222 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x223 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x229 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x236 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x52, offset 0x23f + {value: 0x0034, lo: 0x80, hi: 0x80}, + // Block 0x53, offset 0x240 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x54, offset 0x248 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x55, offset 0x251 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x56, offset 0x25a + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x57, offset 0x263 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x58, offset 0x268 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x59, offset 0x26b + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x5a, offset 0x276 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5b, offset 0x284 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5c, offset 0x286 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5d, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5e, offset 0x291 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5f, offset 0x29d + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x60, offset 0x29e + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x61, offset 0x2a9 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x62, offset 0x2b1 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2bf + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x65, offset 0x2c0 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x66, offset 0x2ce + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x67, offset 0x2d3 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x68, offset 0x2d6 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x69, offset 0x2db + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6a, offset 0x2df + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6b, offset 0x2e5 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x2ed + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6e, offset 0x2f2 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6f, offset 0x2f7 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x70, offset 0x2f8 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x71, offset 0x2fe + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x72, offset 0x300 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x76, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x78, offset 0x30b + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7a, offset 0x314 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7b, offset 0x318 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7c, offset 0x31a + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7d, offset 0x31f + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7f, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x80, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x81, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x345 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x83, offset 0x349 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x84, offset 0x34e + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x85, offset 0x356 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x86, offset 0x35c + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x87, offset 0x362 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x88, offset 0x36c + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x89, offset 0x371 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8a, offset 0x37a + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x389 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x38d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8e, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8f, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x90, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x91, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x92, offset 0x39e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x93, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x94, offset 0x3a1 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x95, offset 0x3a2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x96, offset 0x3a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x97, offset 0x3a6 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x98, offset 0x3ac + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x99, offset 0x3b1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3ba + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9c, offset 0x3bd + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9d, offset 0x3bf + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9e, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9f, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa0, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa1, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa2, offset 0x3ce + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa3, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa4, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa5, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa6, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa7, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa8, offset 0x3da + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa9, offset 0x3dd + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xaa, offset 0x3e5 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xab, offset 0x3e8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xac, offset 0x3ec + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xad, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xae, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xaf, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb0, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb1, offset 0x3fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x403 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x416 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x420 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x421 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x422 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x425 + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x428 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc3, offset 0x42b + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc4, offset 0x431 + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x432 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xca, offset 0x445 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcb, offset 0x44c + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcc, offset 0x450 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x454 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xce, offset 0x45d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcf, offset 0x466 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd0, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd1, offset 0x472 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd2, offset 0x47c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd3, offset 0x486 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd5, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x497 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4a3 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd9, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4ac + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdb, offset 0x4af + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xdc, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdd, offset 0x4b9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xde, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdf, offset 0x4c4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe0, offset 0x4c5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe1, offset 0x4c8 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4d2 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe4, offset 0x4d7 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe5, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe6, offset 0x4e6 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe7, offset 0x4ec + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe8, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe9, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xea, offset 0x4f9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xeb, offset 0x4fc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xed, offset 0x50b + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xee, offset 0x515 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xef, offset 0x51d + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf0, offset 0x520 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf1, offset 0x521 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf2, offset 0x522 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf3, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf4, offset 0x524 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xf5, offset 0x526 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf6, offset 0x527 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf7, offset 0x529 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf8, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf9, offset 0x52d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xfa, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xfb, offset 0x532 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xfc, offset 0x534 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xfd, offset 0x537 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xfe, offset 0x539 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0xff, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x100, offset 0x53e + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x101, offset 0x543 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x102, offset 0x548 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x103, offset 0x54c + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x104, offset 0x54d + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x105, offset 0x550 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x106, offset 0x554 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x107, offset 0x55f + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x108, offset 0x563 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x109, offset 0x56b + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x10a, offset 0x570 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x10b, offset 0x574 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x10c, offset 0x577 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x10d, offset 0x57b + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x57e + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x10f, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x110, offset 0x586 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x111, offset 0x58a + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x112, offset 0x58e + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x113, offset 0x592 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x114, offset 0x596 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x115, offset 0x598 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x116, offset 0x59a + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x117, offset 0x59d + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x118, offset 0x5a2 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x119, offset 0x5a5 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x11a, offset 0x5a7 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x11b, offset 0x5aa + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x11c, offset 0x5ac + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x11d, offset 0x5b2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x11e, offset 0x5bb + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x11f, offset 0x5c0 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x120, offset 0x5c1 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x121, offset 0x5c4 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x122, offset 0x5c5 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x123, offset 0x5c6 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x124, offset 0x5c7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x5c9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x126, offset 0x5ca + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15212 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go new file mode 100644 index 00000000..636d5d14 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables9.0.0.go @@ -0,0 +1,2216 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build !go1.10 +// +build !go1.10 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 795fe57ee5135873. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x36b: 0xed, + 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, + 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf2, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf4, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, + 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, + // Block 0x13, offset 0x4c0 + 0x4c5: 0xff, 0x4c6: 0x100, + 0x4c9: 0x101, + 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, + 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, + 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, + // Block 0x14, offset 0x500 + 0x500: 0x115, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, + 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, + // Block 0x15, offset 0x540 + 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, + 0x54f: 0x11d, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 272 entries, 544 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} + +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0004, lo: 0x82, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x91}, + {value: 0x0004, lo: 0x92, hi: 0x96}, + {value: 0x0054, lo: 0x97, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xac}, + {value: 0x0004, lo: 0xad, hi: 0xad}, + {value: 0x0014, lo: 0xae, hi: 0xae}, + {value: 0x0004, lo: 0xaf, hi: 0xbf}, + // Block 0x6, offset 0x3a + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x3d + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x41 + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x44 + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x48 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x52 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x54 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x59 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x69 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x75 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x83 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x84 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x92 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0xa1 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xae + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xb4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xbc + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + // Block 0x19, offset 0xbe + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xc0 + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xce + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xe2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xed + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + // Block 0x1f, offset 0xf8 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x103 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10f + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + // Block 0x23, offset 0x124 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x147 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x157 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16c + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x189 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x196 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a2 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1be + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1cf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d7 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1ec + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fc + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fe + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x207 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20c + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x219 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x226 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x231 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x232 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x233 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x238 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x255 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x267 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x270 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x275 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x278 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x281 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28e + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x290 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x299 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xad}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0x9f}, + {value: 0x0004, lo: 0xa0, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x327 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32e + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x332 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x344 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34d + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x355 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x361 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36b + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x370 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x379 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37f + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x386 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38a + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x396 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39b + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39d + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39e + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a3 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a9 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ae + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b6 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b9 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3bb + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3ca + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3cb + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d9 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e1 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3f0 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3ff + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x401 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x403 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x412 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41b + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41c + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41d + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x422 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x426 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42c + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x435 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x442 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x451 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x457 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x461 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46b + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x474 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x47a + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x486 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x489 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x49a + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49b + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a2 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a3 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdc, offset 0x4a7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xde, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xdf, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe0, offset 0x4b9 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe1, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe2, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe3, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe4, offset 0x4be + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xe5, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xe6, offset 0x4c2 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xe7, offset 0x4c6 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xe8, offset 0x4c7 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xe9, offset 0x4c9 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xea, offset 0x4ca + {value: 0x0014, lo: 0xa0, hi: 0xa0}, + // Block 0xeb, offset 0x4cb + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xec, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xed, offset 0x4d2 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xee, offset 0x4d7 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xef, offset 0x4db + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf0, offset 0x4dc + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf1, offset 0x4df + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf2, offset 0x4e3 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf3, offset 0x4ee + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf4, offset 0x4f2 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xf5, offset 0x4fa + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xf6, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xf7, offset 0x503 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xf8, offset 0x506 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xf9, offset 0x50a + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x50d + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfb, offset 0x510 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0xfc, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0xfd, offset 0x519 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0xfe, offset 0x51d + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xff, offset 0x521 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x100, offset 0x525 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x101, offset 0x527 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x102, offset 0x529 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x103, offset 0x52c + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x104, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x105, offset 0x533 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x106, offset 0x538 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x107, offset 0x541 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x108, offset 0x546 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x109, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x10b, offset 0x54b + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x54c + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x10d, offset 0x54e + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x10e, offset 0x54f + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14027 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go new file mode 100644 index 00000000..4e4d13fe --- /dev/null +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -0,0 +1,217 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package cases + +// This file contains definitions for interpreting the trie value of the case +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds case information for a single rune. It is the value returned +// by a trie lookup. Most mapping information can be stored in a single 16-bit +// value. If not, for example when a rune is mapped to multiple runes, the value +// stores some basic case data and an index into an array with additional data. +// +// The per-rune values have the following format: +// +// if (exception) { +// 15..4 unsigned exception index +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode +// +// For the non-exceptional cases, a rune must be either uncased, lowercase or +// uppercase. If the rune is cased, the XOR pattern maps either a lowercase +// rune to uppercase or an uppercase rune to lowercase (applied to the 10 +// least-significant bits of the rune). +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + casedMask = 0x0003 + fullCasedMask = 0x0007 + ignorableMask = 0x0006 + ignorableValue = 0x0004 + + inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 + + exceptionBit = 1 << 3 + exceptionShift = 4 + numExceptionBits = 12 + + xorIndexBit = 1 << 6 + xorShift = 8 + + // There is no mapping if all xor bits and the exception bit are zero. + hasMappingMask = 0xff80 | exceptionBit +) + +// The case mode bits encodes the case type of a rune. This includes uncased, +// title, upper and lower case and case ignorable. (For a definition of these +// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare +// cases, a rune can be both cased and case-ignorable. This is encoded by +// cIgnorableCased. A rune of this type is always lower case. Some runes are +// cased while not having a mapping. +// +// A common pattern for scripts in the Unicode standard is for upper and lower +// case runes to alternate for increasing rune values (e.g. the accented Latin +// ranges starting from U+0100 and U+1E00 among others and some Cyrillic +// characters). We use this property by defining a cXORCase mode, where the case +// mode (always upper or lower case) is derived from the rune value. As the XOR +// pattern for case mappings is often identical for successive runes, using +// cXORCase can result in large series of identical trie values. This, in turn, +// allows us to better compress the trie blocks. +const ( + cUncased info = iota // 000 + cTitle // 001 + cLower // 010 + cUpper // 011 + cIgnorableUncased // 100 + cIgnorableCased // 101 // lower case if mappings exist + cXORCase // 11x // case is cLower | ((rune&1) ^ x) + + maxCaseMode = cUpper +) + +func (c info) isCased() bool { + return c&casedMask != 0 +} + +func (c info) isCaseIgnorable() bool { + return c&ignorableMask == ignorableValue +} + +func (c info) isNotCasedAndNotCaseIgnorable() bool { + return c&fullCasedMask == 0 +} + +func (c info) isCaseIgnorableAndNotCased() bool { + return c&fullCasedMask == cIgnorableUncased +} + +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + +// The case mapping implementation will need to know about various Canonical +// Combining Class (CCC) values. We encode two of these in the trie value: +// cccZero (0) and cccAbove (230). If the value is cccOther, it means that +// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that +// the rune also has the break category Break (see below). +const ( + cccBreak info = iota << 4 + cccZero + cccAbove + cccOther + + cccMask = cccBreak | cccZero | cccAbove | cccOther +) + +const ( + starter = 0 + above = 230 + iotaSubscript = 240 +) + +// The exceptions slice holds data that does not fit in a normal info entry. +// The entry is pointed to by the exception index in an entry. It has the +// following format: +// +// Header: +// +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold +// +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper +// +// Lengths with the value 0x7 indicate no value and implies no change. +// A length of 0 indicates a mapping to zero-length string. +// +// Body bytes: +// +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// Fallbacks: +// +// missing fold -> lower +// missing title -> upper +// all missing -> original rune +// +// exceptions starts with a dummy byte to enforce that there is no zero index +// value. +const ( + lengthMask = 0x07 + lengthBits = 3 + noChange = 0 +) + +// References to generated trie. + +var trie = newCaseTrie(0) + +var sparse = sparseBlocks{ + values: sparseValues[:], + offsets: sparseOffsets[:], +} + +// Sparse block lookup code. + +// valueRange is an entry in a sparse block. +type valueRange struct { + value uint16 + lo, hi byte +} + +type sparseBlocks struct { + values []valueRange + offsets []uint16 +} + +// lookup returns the value from values block n for byte b using binary search. +func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { + lo := s.offsets[n] + hi := s.offsets[n+1] + for lo < hi { + m := lo + (hi-lo)/2 + r := s.values[m] + if r.lo <= b && b <= r.hi { + return r.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} + +// lastRuneForTesting is the last rune used for testing. Everything after this +// is boring. +const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 00000000..3cddbbdd --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,49 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 00000000..cdfdb749 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 00000000..46a00150 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 00000000..1b36935e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 00000000..83816a72 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 00000000..8d810723 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 00000000..32af9de5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x05820000, + 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x43220000, 0x43220033, 0x432200bd, 0x43220105, + 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, + 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, + 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, + 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + // Entry 300 - 31F + 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 6772C83C diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 00000000..ca135d29 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 00000000..4ae78e0f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 00000000..9b20b88f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 00000000..6105bc7f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 00000000..231b4fbd --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 00000000..75a2dbca --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 00000000..aad1e0ac --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 00000000..fb6b5837 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3472 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8752 + +const NumScripts = 258 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 716 bytes, 179 elements +var AliasMap = [179]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x709, To: 0x3625}, + 20: {From: 0x73e, To: 0x21a1}, + 21: {From: 0x7b3, To: 0x56}, + 22: {From: 0x7b9, To: 0x299b}, + 23: {From: 0x7c5, To: 0x58}, + 24: {From: 0x7e6, To: 0x145}, + 25: {From: 0x80c, To: 0x5a}, + 26: {From: 0x815, To: 0x8d}, + 27: {From: 0x87e, To: 0x810}, + 28: {From: 0x8a8, To: 0x8b7}, + 29: {From: 0x8c3, To: 0xee3}, + 30: {From: 0x8fa, To: 0x1dc}, + 31: {From: 0x9ef, To: 0x331}, + 32: {From: 0xa36, To: 0x2c5}, + 33: {From: 0xa3d, To: 0xbf}, + 34: {From: 0xabe, To: 0x3322}, + 35: {From: 0xb38, To: 0x529}, + 36: {From: 0xb75, To: 0x265a}, + 37: {From: 0xb7e, To: 0xbc3}, + 38: {From: 0xb9b, To: 0x44e}, + 39: {From: 0xbbc, To: 0x4229}, + 40: {From: 0xbbf, To: 0x529}, + 41: {From: 0xbfe, To: 0x2da7}, + 42: {From: 0xc2e, To: 0x3181}, + 43: {From: 0xcb9, To: 0xf3}, + 44: {From: 0xd08, To: 0xfa}, + 45: {From: 0xdc8, To: 0x11a}, + 46: {From: 0xdd7, To: 0x32d}, + 47: {From: 0xdf8, To: 0xdfb}, + 48: {From: 0xdfe, To: 0x531}, + 49: {From: 0xe01, To: 0xdf3}, + 50: {From: 0xedf, To: 0x205a}, + 51: {From: 0xee9, To: 0x222e}, + 52: {From: 0xeee, To: 0x2e9a}, + 53: {From: 0xf39, To: 0x367}, + 54: {From: 0x10d0, To: 0x140}, + 55: {From: 0x1104, To: 0x2d0}, + 56: {From: 0x11a0, To: 0x1ec}, + 57: {From: 0x1279, To: 0x21}, + 58: {From: 0x1424, To: 0x15e}, + 59: {From: 0x1470, To: 0x14e}, + 60: {From: 0x151f, To: 0xd9b}, + 61: {From: 0x1523, To: 0x390}, + 62: {From: 0x1532, To: 0x19f}, + 63: {From: 0x1580, To: 0x210}, + 64: {From: 0x1583, To: 0x10d}, + 65: {From: 0x15a3, To: 0x3caf}, + 66: {From: 0x1630, To: 0x222e}, + 67: {From: 0x166a, To: 0x19b}, + 68: {From: 0x16c8, To: 0x136}, + 69: {From: 0x1700, To: 0x29f8}, + 70: {From: 0x1718, To: 0x194}, + 71: {From: 0x1727, To: 0xf3f}, + 72: {From: 0x177a, To: 0x178}, + 73: {From: 0x1809, To: 0x17b6}, + 74: {From: 0x1816, To: 0x18f3}, + 75: {From: 0x188a, To: 0x436}, + 76: {From: 0x1979, To: 0x1d01}, + 77: {From: 0x1a74, To: 0x2bb0}, + 78: {From: 0x1a8a, To: 0x1f8}, + 79: {From: 0x1b5a, To: 0x1fa}, + 80: {From: 0x1b86, To: 0x1515}, + 81: {From: 0x1d64, To: 0x2c9b}, + 82: {From: 0x2038, To: 0x37b1}, + 83: {From: 0x203d, To: 0x20dd}, + 84: {From: 0x205a, To: 0x30b}, + 85: {From: 0x20e3, To: 0x274}, + 86: {From: 0x20ee, To: 0x263}, + 87: {From: 0x20f2, To: 0x22d}, + 88: {From: 0x20f9, To: 0x256}, + 89: {From: 0x210f, To: 0x21eb}, + 90: {From: 0x2135, To: 0x27d}, + 91: {From: 0x2160, To: 0x913}, + 92: {From: 0x2199, To: 0x121}, + 93: {From: 0x21ce, To: 0x1561}, + 94: {From: 0x21e6, To: 0x504}, + 95: {From: 0x21f4, To: 0x49f}, + 96: {From: 0x21fb, To: 0x269}, + 97: {From: 0x222d, To: 0x121}, + 98: {From: 0x2237, To: 0x121}, + 99: {From: 0x2262, To: 0x92a}, + 100: {From: 0x2316, To: 0x3226}, + 101: {From: 0x236a, To: 0x2835}, + 102: {From: 0x2382, To: 0x3365}, + 103: {From: 0x2472, To: 0x2c7}, + 104: {From: 0x24e4, To: 0x2ff}, + 105: {From: 0x24f0, To: 0x2fa}, + 106: {From: 0x24fa, To: 0x31f}, + 107: {From: 0x2550, To: 0xb5b}, + 108: {From: 0x25a9, To: 0xe2}, + 109: {From: 0x263e, To: 0x2d0}, + 110: {From: 0x26c9, To: 0x26b4}, + 111: {From: 0x26f9, To: 0x3c8}, + 112: {From: 0x2727, To: 0x3caf}, + 113: {From: 0x2755, To: 0x6a4}, + 114: {From: 0x2765, To: 0x26b4}, + 115: {From: 0x2789, To: 0x4358}, + 116: {From: 0x27c9, To: 0x2001}, + 117: {From: 0x28ea, To: 0x27b1}, + 118: {From: 0x28ef, To: 0x2837}, + 119: {From: 0x2914, To: 0x351}, + 120: {From: 0x2986, To: 0x2da7}, + 121: {From: 0x29f0, To: 0x96b}, + 122: {From: 0x2b1a, To: 0x38d}, + 123: {From: 0x2bfc, To: 0x395}, + 124: {From: 0x2c3f, To: 0x3caf}, + 125: {From: 0x2ce1, To: 0x2201}, + 126: {From: 0x2cfc, To: 0x3be}, + 127: {From: 0x2d13, To: 0x597}, + 128: {From: 0x2d47, To: 0x148}, + 129: {From: 0x2d48, To: 0x148}, + 130: {From: 0x2dff, To: 0x2f1}, + 131: {From: 0x2e08, To: 0x19cc}, + 132: {From: 0x2e1a, To: 0x2d95}, + 133: {From: 0x2e21, To: 0x292}, + 134: {From: 0x2e54, To: 0x7d}, + 135: {From: 0x2e65, To: 0x2282}, + 136: {From: 0x2ea0, To: 0x2e9b}, + 137: {From: 0x2eef, To: 0x2ed7}, + 138: {From: 0x3193, To: 0x3c4}, + 139: {From: 0x3366, To: 0x338e}, + 140: {From: 0x342a, To: 0x3dc}, + 141: {From: 0x34ee, To: 0x18d0}, + 142: {From: 0x35c8, To: 0x2c9b}, + 143: {From: 0x35e6, To: 0x412}, + 144: {From: 0x3658, To: 0x246}, + 145: {From: 0x3676, To: 0x3f4}, + 146: {From: 0x36fd, To: 0x445}, + 147: {From: 0x37c0, To: 0x121}, + 148: {From: 0x3816, To: 0x38f2}, + 149: {From: 0x382a, To: 0x2b48}, + 150: {From: 0x382b, To: 0x2c9b}, + 151: {From: 0x382f, To: 0xa9}, + 152: {From: 0x3832, To: 0x3228}, + 153: {From: 0x386c, To: 0x39a6}, + 154: {From: 0x3892, To: 0x3fc0}, + 155: {From: 0x38a5, To: 0x39d7}, + 156: {From: 0x38b4, To: 0x1fa4}, + 157: {From: 0x38b5, To: 0x2e9a}, + 158: {From: 0x395c, To: 0x47e}, + 159: {From: 0x3b4e, To: 0xd91}, + 160: {From: 0x3b78, To: 0x137}, + 161: {From: 0x3c99, To: 0x4bc}, + 162: {From: 0x3fbd, To: 0x100}, + 163: {From: 0x4208, To: 0xa91}, + 164: {From: 0x42be, To: 0x573}, + 165: {From: 0x42f9, To: 0x3f60}, + 166: {From: 0x4378, To: 0x25a}, + 167: {From: 0x43b8, To: 0xe6c}, + 168: {From: 0x43cd, To: 0x10f}, + 169: {From: 0x44af, To: 0x3322}, + 170: {From: 0x44e3, To: 0x512}, + 171: {From: 0x45ca, To: 0x2409}, + 172: {From: 0x45dd, To: 0x26dc}, + 173: {From: 0x4610, To: 0x48ae}, + 174: {From: 0x46ae, To: 0x46a0}, + 175: {From: 0x473e, To: 0x4745}, + 176: {From: 0x4817, To: 0x3503}, + 177: {From: 0x4916, To: 0x31f}, + 178: {From: 0x49a7, To: 0x523}, +} + +// Size: 179 bytes, 179 elements +var AliasTypes = [179]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, + 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, + 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + // Entry 40 - 7F + 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, + 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, + 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + // Entry 80 - BF + 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, + 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, + 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, + 0, 1, 1, +} + +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 147 + _Qaai = 155 + _Qabx = 196 + _Zinh = 252 + _Zyyy = 257 + _Zzzz = 258 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1040 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + + "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + + "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + + "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + + "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + + "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + + "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + + "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + + "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + + "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + + "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + // Entry 140 - 17F + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 480 - 4BF + 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 2014 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x61, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x63, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "biscayan": 0x14, + "biske": 0x5c, + "bohoric": 0x15, + "boont": 0x16, + "bornholm": 0x17, + "cisaup": 0x18, + "colb1945": 0x19, + "cornu": 0x1a, + "creiss": 0x1b, + "dajnko": 0x1c, + "ekavsk": 0x1d, + "emodeng": 0x1e, + "fonipa": 0x64, + "fonkirsh": 0x65, + "fonnapa": 0x66, + "fonupa": 0x67, + "fonxsamp": 0x68, + "gascon": 0x1f, + "grclass": 0x20, + "grital": 0x21, + "grmistr": 0x22, + "hepburn": 0x23, + "heploc": 0x62, + "hognorsk": 0x24, + "hsistemo": 0x25, + "ijekavsk": 0x26, + "itihasa": 0x27, + "ivanchov": 0x28, + "jauer": 0x29, + "jyutping": 0x2a, + "kkcor": 0x2b, + "kociewie": 0x2c, + "kscor": 0x2d, + "laukika": 0x2e, + "lemosin": 0x2f, + "lengadoc": 0x30, + "lipaw": 0x5d, + "luna1918": 0x31, + "metelko": 0x32, + "monoton": 0x33, + "ndyuka": 0x34, + "nedis": 0x35, + "newfound": 0x36, + "nicard": 0x37, + "njiva": 0x5e, + "nulik": 0x38, + "osojs": 0x5f, + "oxendict": 0x39, + "pahawh2": 0x3a, + "pahawh3": 0x3b, + "pahawh4": 0x3c, + "pamaka": 0x3d, + "peano": 0x3e, + "petr1708": 0x3f, + "pinyin": 0x40, + "polyton": 0x41, + "provenc": 0x42, + "puter": 0x43, + "rigik": 0x44, + "rozaj": 0x45, + "rumgr": 0x46, + "scotland": 0x47, + "scouse": 0x48, + "simple": 0x69, + "solba": 0x60, + "sotav": 0x49, + "spanglis": 0x4a, + "surmiran": 0x4b, + "sursilv": 0x4c, + "sutsilv": 0x4d, + "tarask": 0x4e, + "tongyong": 0x4f, + "tunumiit": 0x50, + "uccor": 0x51, + "ucrcor": 0x52, + "ulster": 0x53, + "unifon": 0x54, + "vaidika": 0x55, + "valencia": 0x56, + "vallader": 0x57, + "vecdruka": 0x58, + "vivaraup": 0x59, + "wadegile": 0x5a, + "xsistemo": 0x5b, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 99 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1040 bytes, 260 elements +var likelyScript = [260]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 29: {lang: 0xf1, region: 0x6b}, + 31: {lang: 0x1a0, region: 0x5d}, + 32: {lang: 0x3e2, region: 0x106}, + 34: {lang: 0x1be, region: 0x99}, + 38: {lang: 0x15e, region: 0x78}, + 41: {lang: 0x133, region: 0x6b}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x6f}, + 46: {lang: 0x210, region: 0x7d}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x99}, + 50: {lang: 0x19e, region: 0x130}, + 51: {lang: 0x3e9, region: 0x99}, + 52: {lang: 0x136, region: 0x87}, + 53: {lang: 0x1a4, region: 0x99}, + 54: {lang: 0x39d, region: 0x99}, + 55: {lang: 0x529, region: 0x12e}, + 56: {lang: 0x254, region: 0xab}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe7}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12e}, + 61: {lang: 0x2fd, region: 0x9b}, + 62: {lang: 0x1bc, region: 0x97}, + 63: {lang: 0x200, region: 0xa2}, + 64: {lang: 0x1c5, region: 0x12b}, + 65: {lang: 0x1ca, region: 0xaf}, + 68: {lang: 0x1d5, region: 0x92}, + 70: {lang: 0x142, region: 0x9e}, + 71: {lang: 0x254, region: 0xab}, + 72: {lang: 0x20e, region: 0x95}, + 73: {lang: 0x200, region: 0xa2}, + 75: {lang: 0x135, region: 0xc4}, + 76: {lang: 0x200, region: 0xa2}, + 77: {lang: 0x3bb, region: 0xe8}, + 78: {lang: 0x24a, region: 0xa6}, + 79: {lang: 0x3fa, region: 0x99}, + 82: {lang: 0x251, region: 0x99}, + 83: {lang: 0x254, region: 0xab}, + 85: {lang: 0x88, region: 0x99}, + 86: {lang: 0x370, region: 0x123}, + 87: {lang: 0x2b8, region: 0xaf}, + 92: {lang: 0x29f, region: 0x99}, + 93: {lang: 0x2a8, region: 0x99}, + 94: {lang: 0x28f, region: 0x87}, + 95: {lang: 0x1a0, region: 0x87}, + 96: {lang: 0x2ac, region: 0x53}, + 98: {lang: 0x4f4, region: 0x12b}, + 99: {lang: 0x4f5, region: 0x12b}, + 100: {lang: 0x1be, region: 0x99}, + 102: {lang: 0x337, region: 0x9c}, + 103: {lang: 0x4f7, region: 0x53}, + 104: {lang: 0xa9, region: 0x53}, + 107: {lang: 0x2e8, region: 0x112}, + 108: {lang: 0x4f8, region: 0x10b}, + 109: {lang: 0x4f8, region: 0x10b}, + 110: {lang: 0x304, region: 0x99}, + 111: {lang: 0x31b, region: 0x99}, + 112: {lang: 0x30b, region: 0x53}, + 114: {lang: 0x31e, region: 0x35}, + 115: {lang: 0x30e, region: 0x99}, + 116: {lang: 0x414, region: 0xe8}, + 117: {lang: 0x331, region: 0xc4}, + 119: {lang: 0x4f9, region: 0x108}, + 120: {lang: 0x3b, region: 0xa1}, + 121: {lang: 0x353, region: 0xdb}, + 124: {lang: 0x2d0, region: 0x84}, + 125: {lang: 0x52a, region: 0x53}, + 126: {lang: 0x403, region: 0x96}, + 127: {lang: 0x3ee, region: 0x99}, + 128: {lang: 0x39b, region: 0xc5}, + 129: {lang: 0x395, region: 0x99}, + 130: {lang: 0x399, region: 0x135}, + 131: {lang: 0x429, region: 0x115}, + 133: {lang: 0x3b, region: 0x11c}, + 134: {lang: 0xfd, region: 0xc4}, + 137: {lang: 0x27d, region: 0x106}, + 138: {lang: 0x2c9, region: 0x53}, + 139: {lang: 0x39f, region: 0x9c}, + 140: {lang: 0x39f, region: 0x53}, + 142: {lang: 0x3ad, region: 0xb0}, + 144: {lang: 0x1c6, region: 0x53}, + 145: {lang: 0x4fd, region: 0x9c}, + 198: {lang: 0x3cb, region: 0x95}, + 201: {lang: 0x372, region: 0x10c}, + 202: {lang: 0x420, region: 0x97}, + 204: {lang: 0x4ff, region: 0x15e}, + 205: {lang: 0x3f0, region: 0x99}, + 206: {lang: 0x45, region: 0x135}, + 207: {lang: 0x139, region: 0x7b}, + 208: {lang: 0x3e9, region: 0x99}, + 210: {lang: 0x3e9, region: 0x99}, + 211: {lang: 0x3fa, region: 0x99}, + 212: {lang: 0x40c, region: 0xb3}, + 215: {lang: 0x433, region: 0x99}, + 216: {lang: 0xef, region: 0xc5}, + 217: {lang: 0x43e, region: 0x95}, + 218: {lang: 0x44d, region: 0x35}, + 219: {lang: 0x44e, region: 0x9b}, + 223: {lang: 0x45a, region: 0xe7}, + 224: {lang: 0x11a, region: 0x99}, + 225: {lang: 0x45e, region: 0x53}, + 226: {lang: 0x232, region: 0x53}, + 227: {lang: 0x450, region: 0x99}, + 228: {lang: 0x4a5, region: 0x53}, + 229: {lang: 0x9f, region: 0x13e}, + 230: {lang: 0x461, region: 0x99}, + 232: {lang: 0x528, region: 0xba}, + 233: {lang: 0x153, region: 0xe7}, + 234: {lang: 0x128, region: 0xcd}, + 235: {lang: 0x46b, region: 0x123}, + 236: {lang: 0xa9, region: 0x53}, + 237: {lang: 0x2ce, region: 0x99}, + 240: {lang: 0x4ad, region: 0x11c}, + 241: {lang: 0x4be, region: 0xb4}, + 244: {lang: 0x1ce, region: 0x99}, + 247: {lang: 0x3a9, region: 0x9c}, + 248: {lang: 0x22, region: 0x9b}, + 250: {lang: 0x1ea, region: 0x53}, + 251: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x5a, flags: 0x0}, + 1: {region: 0x6f, script: 0x5a, flags: 0x0}, + 2: {region: 0x165, script: 0x5a, flags: 0x0}, + 3: {region: 0x165, script: 0x5a, flags: 0x0}, + 4: {region: 0x165, script: 0x5a, flags: 0x0}, + 5: {region: 0x7d, script: 0x20, flags: 0x0}, + 6: {region: 0x165, script: 0x5a, flags: 0x0}, + 7: {region: 0x165, script: 0x20, flags: 0x0}, + 8: {region: 0x80, script: 0x5a, flags: 0x0}, + 9: {region: 0x165, script: 0x5a, flags: 0x0}, + 10: {region: 0x165, script: 0x5a, flags: 0x0}, + 11: {region: 0x165, script: 0x5a, flags: 0x0}, + 12: {region: 0x95, script: 0x5a, flags: 0x0}, + 13: {region: 0x131, script: 0x5a, flags: 0x0}, + 14: {region: 0x80, script: 0x5a, flags: 0x0}, + 15: {region: 0x165, script: 0x5a, flags: 0x0}, + 16: {region: 0x165, script: 0x5a, flags: 0x0}, + 17: {region: 0x106, script: 0x20, flags: 0x0}, + 18: {region: 0x165, script: 0x5a, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x5a, flags: 0x0}, + 22: {region: 0x161, script: 0x5a, flags: 0x0}, + 23: {region: 0x165, script: 0x5a, flags: 0x0}, + 24: {region: 0x165, script: 0x5a, flags: 0x0}, + 25: {region: 0x165, script: 0x5a, flags: 0x0}, + 26: {region: 0x165, script: 0x5a, flags: 0x0}, + 27: {region: 0x165, script: 0x5a, flags: 0x0}, + 28: {region: 0x52, script: 0x5a, flags: 0x0}, + 29: {region: 0x165, script: 0x5a, flags: 0x0}, + 30: {region: 0x165, script: 0x5a, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x5a, flags: 0x0}, + 33: {region: 0x80, script: 0x5a, flags: 0x0}, + 34: {region: 0x9b, script: 0xf8, flags: 0x0}, + 35: {region: 0x165, script: 0x5a, flags: 0x0}, + 36: {region: 0x165, script: 0x5a, flags: 0x0}, + 37: {region: 0x14d, script: 0x5a, flags: 0x0}, + 38: {region: 0x106, script: 0x20, flags: 0x0}, + 39: {region: 0x6f, script: 0x2c, flags: 0x0}, + 40: {region: 0x165, script: 0x5a, flags: 0x0}, + 41: {region: 0x165, script: 0x5a, flags: 0x0}, + 42: {region: 0xd6, script: 0x5a, flags: 0x0}, + 43: {region: 0x165, script: 0x5a, flags: 0x0}, + 45: {region: 0x165, script: 0x5a, flags: 0x0}, + 46: {region: 0x165, script: 0x5a, flags: 0x0}, + 47: {region: 0x165, script: 0x5a, flags: 0x0}, + 48: {region: 0x165, script: 0x5a, flags: 0x0}, + 49: {region: 0x165, script: 0x5a, flags: 0x0}, + 50: {region: 0x165, script: 0x5a, flags: 0x0}, + 51: {region: 0x95, script: 0x5a, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x5a, flags: 0x0}, + 55: {region: 0x165, script: 0x5a, flags: 0x0}, + 56: {region: 0x165, script: 0x5a, flags: 0x0}, + 57: {region: 0x165, script: 0x5a, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x5a, flags: 0x0}, + 61: {region: 0x51, script: 0x5a, flags: 0x0}, + 62: {region: 0x3f, script: 0x5a, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x5a, flags: 0x0}, + 69: {region: 0x135, script: 0xce, flags: 0x0}, + 70: {region: 0x165, script: 0x5a, flags: 0x0}, + 71: {region: 0x165, script: 0x5a, flags: 0x0}, + 72: {region: 0x6e, script: 0x5a, flags: 0x0}, + 73: {region: 0x165, script: 0x5a, flags: 0x0}, + 74: {region: 0x165, script: 0x5a, flags: 0x0}, + 75: {region: 0x49, script: 0x5a, flags: 0x0}, + 76: {region: 0x165, script: 0x5a, flags: 0x0}, + 77: {region: 0x106, script: 0x20, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x5a, flags: 0x0}, + 80: {region: 0x165, script: 0x5a, flags: 0x0}, + 81: {region: 0x165, script: 0x5a, flags: 0x0}, + 82: {region: 0x99, script: 0x22, flags: 0x0}, + 83: {region: 0x165, script: 0x5a, flags: 0x0}, + 84: {region: 0x165, script: 0x5a, flags: 0x0}, + 85: {region: 0x165, script: 0x5a, flags: 0x0}, + 86: {region: 0x3f, script: 0x5a, flags: 0x0}, + 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x20, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x5a, flags: 0x0}, + 92: {region: 0xdb, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5a, flags: 0x0}, + 94: {region: 0x52, script: 0x5a, flags: 0x0}, + 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x5a, flags: 0x0}, + 98: {region: 0x165, script: 0x5a, flags: 0x0}, + 99: {region: 0x95, script: 0x5a, flags: 0x0}, + 100: {region: 0x165, script: 0x5a, flags: 0x0}, + 101: {region: 0x52, script: 0x5a, flags: 0x0}, + 102: {region: 0x165, script: 0x5a, flags: 0x0}, + 103: {region: 0x165, script: 0x5a, flags: 0x0}, + 104: {region: 0x165, script: 0x5a, flags: 0x0}, + 105: {region: 0x165, script: 0x5a, flags: 0x0}, + 106: {region: 0x4f, script: 0x5a, flags: 0x0}, + 107: {region: 0x165, script: 0x5a, flags: 0x0}, + 108: {region: 0x165, script: 0x5a, flags: 0x0}, + 109: {region: 0x165, script: 0x5a, flags: 0x0}, + 110: {region: 0x165, script: 0x2c, flags: 0x0}, + 111: {region: 0x165, script: 0x5a, flags: 0x0}, + 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x165, script: 0x5a, flags: 0x0}, + 115: {region: 0x165, script: 0x5a, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x5a, flags: 0x0}, + 118: {region: 0x165, script: 0x5a, flags: 0x0}, + 119: {region: 0x95, script: 0x5a, flags: 0x0}, + 120: {region: 0x165, script: 0x5a, flags: 0x0}, + 121: {region: 0x12f, script: 0x5a, flags: 0x0}, + 122: {region: 0x52, script: 0x5a, flags: 0x0}, + 123: {region: 0x99, script: 0xe3, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x99, script: 0x22, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x34, flags: 0x0}, + 131: {region: 0x99, script: 0x22, flags: 0x0}, + 132: {region: 0x165, script: 0x5a, flags: 0x0}, + 133: {region: 0x99, script: 0x22, flags: 0x0}, + 134: {region: 0xe7, script: 0x5a, flags: 0x0}, + 135: {region: 0x165, script: 0x5a, flags: 0x0}, + 136: {region: 0x99, script: 0x22, flags: 0x0}, + 137: {region: 0x165, script: 0x5a, flags: 0x0}, + 138: {region: 0x13f, script: 0x5a, flags: 0x0}, + 139: {region: 0x165, script: 0x5a, flags: 0x0}, + 140: {region: 0x165, script: 0x5a, flags: 0x0}, + 141: {region: 0xe7, script: 0x5a, flags: 0x0}, + 142: {region: 0x165, script: 0x5a, flags: 0x0}, + 143: {region: 0xd6, script: 0x5a, flags: 0x0}, + 144: {region: 0x165, script: 0x5a, flags: 0x0}, + 145: {region: 0x165, script: 0x5a, flags: 0x0}, + 146: {region: 0x165, script: 0x5a, flags: 0x0}, + 147: {region: 0x165, script: 0x2c, flags: 0x0}, + 148: {region: 0x99, script: 0x22, flags: 0x0}, + 149: {region: 0x95, script: 0x5a, flags: 0x0}, + 150: {region: 0x165, script: 0x5a, flags: 0x0}, + 151: {region: 0x165, script: 0x5a, flags: 0x0}, + 152: {region: 0x114, script: 0x5a, flags: 0x0}, + 153: {region: 0x165, script: 0x5a, flags: 0x0}, + 154: {region: 0x165, script: 0x5a, flags: 0x0}, + 155: {region: 0x52, script: 0x5a, flags: 0x0}, + 156: {region: 0x165, script: 0x5a, flags: 0x0}, + 157: {region: 0xe7, script: 0x5a, flags: 0x0}, + 158: {region: 0x165, script: 0x5a, flags: 0x0}, + 159: {region: 0x13e, script: 0xe5, flags: 0x0}, + 160: {region: 0xc3, script: 0x5a, flags: 0x0}, + 161: {region: 0x165, script: 0x5a, flags: 0x0}, + 162: {region: 0x165, script: 0x5a, flags: 0x0}, + 163: {region: 0xc3, script: 0x5a, flags: 0x0}, + 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x5a, flags: 0x0}, + 167: {region: 0x165, script: 0x5a, flags: 0x0}, + 168: {region: 0x165, script: 0x5a, flags: 0x0}, + 169: {region: 0x53, script: 0xec, flags: 0x0}, + 170: {region: 0x165, script: 0x5a, flags: 0x0}, + 171: {region: 0x165, script: 0x5a, flags: 0x0}, + 172: {region: 0x165, script: 0x5a, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x5a, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x5a, flags: 0x0}, + 177: {region: 0x4f, script: 0x5a, flags: 0x0}, + 178: {region: 0x78, script: 0x5a, flags: 0x0}, + 179: {region: 0x99, script: 0x22, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x22, flags: 0x0}, + 182: {region: 0x165, script: 0x5a, flags: 0x0}, + 183: {region: 0x33, script: 0x5a, flags: 0x0}, + 184: {region: 0x165, script: 0x5a, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5a, flags: 0x0}, + 187: {region: 0x165, script: 0x2c, flags: 0x0}, + 188: {region: 0xe7, script: 0x5a, flags: 0x0}, + 189: {region: 0x165, script: 0x5a, flags: 0x0}, + 190: {region: 0xe8, script: 0x22, flags: 0x0}, + 191: {region: 0x106, script: 0x20, flags: 0x0}, + 192: {region: 0x15f, script: 0x5a, flags: 0x0}, + 193: {region: 0x165, script: 0x5a, flags: 0x0}, + 194: {region: 0x95, script: 0x5a, flags: 0x0}, + 195: {region: 0x165, script: 0x5a, flags: 0x0}, + 196: {region: 0x52, script: 0x5a, flags: 0x0}, + 197: {region: 0x165, script: 0x5a, flags: 0x0}, + 198: {region: 0x165, script: 0x5a, flags: 0x0}, + 199: {region: 0x165, script: 0x5a, flags: 0x0}, + 200: {region: 0x86, script: 0x5a, flags: 0x0}, + 201: {region: 0x165, script: 0x5a, flags: 0x0}, + 202: {region: 0x165, script: 0x5a, flags: 0x0}, + 203: {region: 0x165, script: 0x5a, flags: 0x0}, + 204: {region: 0x165, script: 0x5a, flags: 0x0}, + 205: {region: 0x6d, script: 0x2c, flags: 0x0}, + 206: {region: 0x165, script: 0x5a, flags: 0x0}, + 207: {region: 0x165, script: 0x5a, flags: 0x0}, + 208: {region: 0x52, script: 0x5a, flags: 0x0}, + 209: {region: 0x165, script: 0x5a, flags: 0x0}, + 210: {region: 0x165, script: 0x5a, flags: 0x0}, + 211: {region: 0xc3, script: 0x5a, flags: 0x0}, + 212: {region: 0x165, script: 0x5a, flags: 0x0}, + 213: {region: 0x165, script: 0x5a, flags: 0x0}, + 214: {region: 0x165, script: 0x5a, flags: 0x0}, + 215: {region: 0x6e, script: 0x5a, flags: 0x0}, + 216: {region: 0x165, script: 0x5a, flags: 0x0}, + 217: {region: 0x165, script: 0x5a, flags: 0x0}, + 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x20, flags: 0x0}, + 221: {region: 0xe7, script: 0x5a, flags: 0x0}, + 222: {region: 0x165, script: 0x5a, flags: 0x0}, + 223: {region: 0x131, script: 0x5a, flags: 0x0}, + 224: {region: 0x8a, script: 0x5a, flags: 0x0}, + 225: {region: 0x75, script: 0x5a, flags: 0x0}, + 226: {region: 0x106, script: 0x20, flags: 0x0}, + 227: {region: 0x135, script: 0x5a, flags: 0x0}, + 228: {region: 0x49, script: 0x5a, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x5a, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x5a, flags: 0x0}, + 235: {region: 0x165, script: 0x5a, flags: 0x0}, + 236: {region: 0x165, script: 0x5a, flags: 0x0}, + 237: {region: 0x165, script: 0x5a, flags: 0x0}, + 238: {region: 0x165, script: 0x5a, flags: 0x0}, + 239: {region: 0xc5, script: 0xd8, flags: 0x0}, + 240: {region: 0x78, script: 0x5a, flags: 0x0}, + 241: {region: 0x6b, script: 0x1d, flags: 0x0}, + 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x5a, flags: 0x0}, + 250: {region: 0x5e, script: 0x5a, flags: 0x0}, + 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x20, flags: 0x0}, + 256: {region: 0x7b, script: 0x5a, flags: 0x0}, + 257: {region: 0x63, script: 0x5a, flags: 0x0}, + 258: {region: 0x165, script: 0x5a, flags: 0x0}, + 259: {region: 0x165, script: 0x5a, flags: 0x0}, + 260: {region: 0x165, script: 0x5a, flags: 0x0}, + 261: {region: 0x165, script: 0x5a, flags: 0x0}, + 262: {region: 0x135, script: 0x5a, flags: 0x0}, + 263: {region: 0x106, script: 0x20, flags: 0x0}, + 264: {region: 0xa4, script: 0x5a, flags: 0x0}, + 265: {region: 0x165, script: 0x5a, flags: 0x0}, + 266: {region: 0x165, script: 0x5a, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x5a, flags: 0x0}, + 269: {region: 0x60, script: 0x5a, flags: 0x0}, + 270: {region: 0x165, script: 0x5a, flags: 0x0}, + 271: {region: 0x49, script: 0x5a, flags: 0x0}, + 272: {region: 0x165, script: 0x5a, flags: 0x0}, + 273: {region: 0x165, script: 0x5a, flags: 0x0}, + 274: {region: 0x165, script: 0x5a, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5a, flags: 0x0}, + 277: {region: 0x165, script: 0x5a, flags: 0x0}, + 278: {region: 0x165, script: 0x5a, flags: 0x0}, + 279: {region: 0xd4, script: 0x5a, flags: 0x0}, + 280: {region: 0x4f, script: 0x5a, flags: 0x0}, + 281: {region: 0x165, script: 0x5a, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x5a, flags: 0x0}, + 284: {region: 0x165, script: 0x5a, flags: 0x0}, + 285: {region: 0x165, script: 0x5a, flags: 0x0}, + 286: {region: 0x165, script: 0x2c, flags: 0x0}, + 287: {region: 0x60, script: 0x5a, flags: 0x0}, + 288: {region: 0xc3, script: 0x5a, flags: 0x0}, + 289: {region: 0xd0, script: 0x5a, flags: 0x0}, + 290: {region: 0x165, script: 0x5a, flags: 0x0}, + 291: {region: 0xdb, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5a, flags: 0x0}, + 293: {region: 0x165, script: 0x5a, flags: 0x0}, + 294: {region: 0x165, script: 0x5a, flags: 0x0}, + 295: {region: 0x165, script: 0x5a, flags: 0x0}, + 296: {region: 0xcd, script: 0xea, flags: 0x0}, + 297: {region: 0x165, script: 0x5a, flags: 0x0}, + 298: {region: 0x165, script: 0x5a, flags: 0x0}, + 299: {region: 0x114, script: 0x5a, flags: 0x0}, + 300: {region: 0x37, script: 0x5a, flags: 0x0}, + 301: {region: 0x43, script: 0xec, flags: 0x0}, + 302: {region: 0x165, script: 0x5a, flags: 0x0}, + 303: {region: 0xa4, script: 0x5a, flags: 0x0}, + 304: {region: 0x80, script: 0x5a, flags: 0x0}, + 305: {region: 0xd6, script: 0x5a, flags: 0x0}, + 306: {region: 0x9e, script: 0x5a, flags: 0x0}, + 307: {region: 0x6b, script: 0x29, flags: 0x0}, + 308: {region: 0x165, script: 0x5a, flags: 0x0}, + 309: {region: 0xc4, script: 0x4b, flags: 0x0}, + 310: {region: 0x87, script: 0x34, flags: 0x0}, + 311: {region: 0x165, script: 0x5a, flags: 0x0}, + 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x5a, flags: 0x0}, + 315: {region: 0x165, script: 0x5a, flags: 0x0}, + 316: {region: 0x1, script: 0x5a, flags: 0x0}, + 317: {region: 0x165, script: 0x5a, flags: 0x0}, + 318: {region: 0x6e, script: 0x5a, flags: 0x0}, + 319: {region: 0x135, script: 0x5a, flags: 0x0}, + 320: {region: 0x6a, script: 0x5a, flags: 0x0}, + 321: {region: 0x165, script: 0x5a, flags: 0x0}, + 322: {region: 0x9e, script: 0x46, flags: 0x0}, + 323: {region: 0x165, script: 0x5a, flags: 0x0}, + 324: {region: 0x165, script: 0x5a, flags: 0x0}, + 325: {region: 0x6e, script: 0x5a, flags: 0x0}, + 326: {region: 0x52, script: 0x5a, flags: 0x0}, + 327: {region: 0x6e, script: 0x5a, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x5a, flags: 0x0}, + 330: {region: 0x165, script: 0x5a, flags: 0x0}, + 331: {region: 0x165, script: 0x5a, flags: 0x0}, + 332: {region: 0x165, script: 0x5a, flags: 0x0}, + 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x5a, flags: 0x0}, + 336: {region: 0xc3, script: 0x5a, flags: 0x0}, + 337: {region: 0x72, script: 0x5a, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x5a, flags: 0x0}, + 340: {region: 0x10c, script: 0x5a, flags: 0x0}, + 341: {region: 0x73, script: 0x5a, flags: 0x0}, + 342: {region: 0x165, script: 0x5a, flags: 0x0}, + 343: {region: 0x165, script: 0x5a, flags: 0x0}, + 344: {region: 0x76, script: 0x5a, flags: 0x0}, + 345: {region: 0x165, script: 0x5a, flags: 0x0}, + 346: {region: 0x3b, script: 0x5a, flags: 0x0}, + 347: {region: 0x165, script: 0x5a, flags: 0x0}, + 348: {region: 0x165, script: 0x5a, flags: 0x0}, + 349: {region: 0x165, script: 0x5a, flags: 0x0}, + 350: {region: 0x78, script: 0x5a, flags: 0x0}, + 351: {region: 0x135, script: 0x5a, flags: 0x0}, + 352: {region: 0x78, script: 0x5a, flags: 0x0}, + 353: {region: 0x60, script: 0x5a, flags: 0x0}, + 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x5a, flags: 0x0}, + 357: {region: 0x165, script: 0x5a, flags: 0x0}, + 358: {region: 0x84, script: 0x5a, flags: 0x0}, + 359: {region: 0x165, script: 0x5a, flags: 0x0}, + 360: {region: 0xd4, script: 0x5a, flags: 0x0}, + 361: {region: 0x9e, script: 0x5a, flags: 0x0}, + 362: {region: 0xd6, script: 0x5a, flags: 0x0}, + 363: {region: 0x165, script: 0x5a, flags: 0x0}, + 364: {region: 0x10b, script: 0x5a, flags: 0x0}, + 365: {region: 0xd9, script: 0x5a, flags: 0x0}, + 366: {region: 0x96, script: 0x5a, flags: 0x0}, + 367: {region: 0x80, script: 0x5a, flags: 0x0}, + 368: {region: 0x165, script: 0x5a, flags: 0x0}, + 369: {region: 0xbc, script: 0x5a, flags: 0x0}, + 370: {region: 0x165, script: 0x5a, flags: 0x0}, + 371: {region: 0x165, script: 0x5a, flags: 0x0}, + 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x165, script: 0x5a, flags: 0x0}, + 375: {region: 0x95, script: 0x5a, flags: 0x0}, + 376: {region: 0x165, script: 0x5a, flags: 0x0}, + 377: {region: 0x165, script: 0x5a, flags: 0x0}, + 378: {region: 0x99, script: 0x22, flags: 0x0}, + 379: {region: 0x165, script: 0x5a, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x5a, flags: 0x0}, + 382: {region: 0x7b, script: 0x5a, flags: 0x0}, + 383: {region: 0x165, script: 0x5a, flags: 0x0}, + 384: {region: 0x165, script: 0x5a, flags: 0x0}, + 385: {region: 0x165, script: 0x5a, flags: 0x0}, + 386: {region: 0x165, script: 0x5a, flags: 0x0}, + 387: {region: 0x165, script: 0x5a, flags: 0x0}, + 388: {region: 0x165, script: 0x5a, flags: 0x0}, + 389: {region: 0x6f, script: 0x2c, flags: 0x0}, + 390: {region: 0x165, script: 0x5a, flags: 0x0}, + 391: {region: 0xdb, script: 0x22, flags: 0x0}, + 392: {region: 0x165, script: 0x5a, flags: 0x0}, + 393: {region: 0xa7, script: 0x5a, flags: 0x0}, + 394: {region: 0x165, script: 0x5a, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x5a, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x5a, flags: 0x0}, + 399: {region: 0x165, script: 0x5a, flags: 0x0}, + 400: {region: 0x6e, script: 0x5a, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x5a, flags: 0x0}, + 403: {region: 0x165, script: 0x2c, flags: 0x0}, + 404: {region: 0xf1, script: 0x5a, flags: 0x0}, + 405: {region: 0x165, script: 0x5a, flags: 0x0}, + 406: {region: 0x165, script: 0x5a, flags: 0x0}, + 407: {region: 0x165, script: 0x5a, flags: 0x0}, + 408: {region: 0x165, script: 0x2c, flags: 0x0}, + 409: {region: 0x165, script: 0x5a, flags: 0x0}, + 410: {region: 0x99, script: 0x22, flags: 0x0}, + 411: {region: 0x99, script: 0xe6, flags: 0x0}, + 412: {region: 0x95, script: 0x5a, flags: 0x0}, + 413: {region: 0xd9, script: 0x5a, flags: 0x0}, + 414: {region: 0x130, script: 0x32, flags: 0x0}, + 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x5a, flags: 0x0}, + 419: {region: 0x4e, script: 0x5a, flags: 0x0}, + 420: {region: 0x99, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5a, flags: 0x0}, + 422: {region: 0x54, script: 0x5a, flags: 0x0}, + 423: {region: 0x165, script: 0x5a, flags: 0x0}, + 424: {region: 0x80, script: 0x5a, flags: 0x0}, + 425: {region: 0x165, script: 0x5a, flags: 0x0}, + 426: {region: 0x165, script: 0x5a, flags: 0x0}, + 427: {region: 0xa4, script: 0x5a, flags: 0x0}, + 428: {region: 0x98, script: 0x5a, flags: 0x0}, + 429: {region: 0x165, script: 0x5a, flags: 0x0}, + 430: {region: 0xdb, script: 0x22, flags: 0x0}, + 431: {region: 0x165, script: 0x5a, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5a, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x165, script: 0x5a, flags: 0x0}, + 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x5a, flags: 0x0}, + 443: {region: 0x165, script: 0x2c, flags: 0x0}, + 444: {region: 0x97, script: 0x3e, flags: 0x0}, + 445: {region: 0x165, script: 0x5a, flags: 0x0}, + 446: {region: 0x99, script: 0x22, flags: 0x0}, + 447: {region: 0x165, script: 0x5a, flags: 0x0}, + 448: {region: 0x73, script: 0x5a, flags: 0x0}, + 449: {region: 0x165, script: 0x5a, flags: 0x0}, + 450: {region: 0x165, script: 0x5a, flags: 0x0}, + 451: {region: 0xe7, script: 0x5a, flags: 0x0}, + 452: {region: 0x165, script: 0x5a, flags: 0x0}, + 453: {region: 0x12b, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x90, flags: 0x0}, + 455: {region: 0x165, script: 0x5a, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x22, flags: 0x0}, + 458: {region: 0xaf, script: 0x41, flags: 0x0}, + 459: {region: 0xe7, script: 0x5a, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x5a, flags: 0x0}, + 462: {region: 0x99, script: 0x22, flags: 0x0}, + 463: {region: 0x99, script: 0x22, flags: 0x0}, + 464: {region: 0x165, script: 0x5a, flags: 0x0}, + 465: {region: 0x90, script: 0x5a, flags: 0x0}, + 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x91, script: 0x5a, flags: 0x0}, + 469: {region: 0x92, script: 0x5a, flags: 0x0}, + 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x5a, flags: 0x0}, + 473: {region: 0x78, script: 0x5a, flags: 0x0}, + 474: {region: 0x165, script: 0x5a, flags: 0x0}, + 475: {region: 0x165, script: 0x5a, flags: 0x0}, + 476: {region: 0xd0, script: 0x5a, flags: 0x0}, + 477: {region: 0xd6, script: 0x5a, flags: 0x0}, + 478: {region: 0x165, script: 0x5a, flags: 0x0}, + 479: {region: 0x165, script: 0x5a, flags: 0x0}, + 480: {region: 0x165, script: 0x5a, flags: 0x0}, + 481: {region: 0x95, script: 0x5a, flags: 0x0}, + 482: {region: 0x165, script: 0x5a, flags: 0x0}, + 483: {region: 0x165, script: 0x5a, flags: 0x0}, + 484: {region: 0x165, script: 0x5a, flags: 0x0}, + 486: {region: 0x122, script: 0x5a, flags: 0x0}, + 487: {region: 0xd6, script: 0x5a, flags: 0x0}, + 488: {region: 0x165, script: 0x5a, flags: 0x0}, + 489: {region: 0x165, script: 0x5a, flags: 0x0}, + 490: {region: 0x53, script: 0xfa, flags: 0x0}, + 491: {region: 0x165, script: 0x5a, flags: 0x0}, + 492: {region: 0x135, script: 0x5a, flags: 0x0}, + 493: {region: 0x165, script: 0x5a, flags: 0x0}, + 494: {region: 0x49, script: 0x5a, flags: 0x0}, + 495: {region: 0x165, script: 0x5a, flags: 0x0}, + 496: {region: 0x165, script: 0x5a, flags: 0x0}, + 497: {region: 0xe7, script: 0x5a, flags: 0x0}, + 498: {region: 0x165, script: 0x5a, flags: 0x0}, + 499: {region: 0x95, script: 0x5a, flags: 0x0}, + 500: {region: 0x106, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5a, flags: 0x0}, + 502: {region: 0x165, script: 0x5a, flags: 0x0}, + 503: {region: 0x165, script: 0x5a, flags: 0x0}, + 504: {region: 0x9d, script: 0x5a, flags: 0x0}, + 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3e, flags: 0x0}, + 508: {region: 0x165, script: 0x5a, flags: 0x0}, + 509: {region: 0x165, script: 0x5a, flags: 0x0}, + 510: {region: 0x106, script: 0x5a, flags: 0x0}, + 511: {region: 0x165, script: 0x5a, flags: 0x0}, + 512: {region: 0xa2, script: 0x49, flags: 0x0}, + 513: {region: 0x165, script: 0x5a, flags: 0x0}, + 514: {region: 0xa0, script: 0x5a, flags: 0x0}, + 515: {region: 0x1, script: 0x5a, flags: 0x0}, + 516: {region: 0x165, script: 0x5a, flags: 0x0}, + 517: {region: 0x165, script: 0x5a, flags: 0x0}, + 518: {region: 0x165, script: 0x5a, flags: 0x0}, + 519: {region: 0x52, script: 0x5a, flags: 0x0}, + 520: {region: 0x130, script: 0x3e, flags: 0x0}, + 521: {region: 0x165, script: 0x5a, flags: 0x0}, + 522: {region: 0x12f, script: 0x5a, flags: 0x0}, + 523: {region: 0xdb, script: 0x22, flags: 0x0}, + 524: {region: 0x165, script: 0x5a, flags: 0x0}, + 525: {region: 0x63, script: 0x5a, flags: 0x0}, + 526: {region: 0x95, script: 0x5a, flags: 0x0}, + 527: {region: 0x95, script: 0x5a, flags: 0x0}, + 528: {region: 0x7d, script: 0x2e, flags: 0x0}, + 529: {region: 0x137, script: 0x20, flags: 0x0}, + 530: {region: 0x67, script: 0x5a, flags: 0x0}, + 531: {region: 0xc4, script: 0x5a, flags: 0x0}, + 532: {region: 0x165, script: 0x5a, flags: 0x0}, + 533: {region: 0x165, script: 0x5a, flags: 0x0}, + 534: {region: 0xd6, script: 0x5a, flags: 0x0}, + 535: {region: 0xa4, script: 0x5a, flags: 0x0}, + 536: {region: 0xc3, script: 0x5a, flags: 0x0}, + 537: {region: 0x106, script: 0x20, flags: 0x0}, + 538: {region: 0x165, script: 0x5a, flags: 0x0}, + 539: {region: 0x165, script: 0x5a, flags: 0x0}, + 540: {region: 0x165, script: 0x5a, flags: 0x0}, + 541: {region: 0x165, script: 0x5a, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x5a, flags: 0x0}, + 544: {region: 0x164, script: 0x5a, flags: 0x0}, + 545: {region: 0x165, script: 0x5a, flags: 0x0}, + 546: {region: 0x165, script: 0x5a, flags: 0x0}, + 547: {region: 0x12f, script: 0x5a, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x5a, flags: 0x0}, + 550: {region: 0x123, script: 0xeb, flags: 0x0}, + 551: {region: 0x5a, script: 0x5a, flags: 0x0}, + 552: {region: 0x52, script: 0x5a, flags: 0x0}, + 553: {region: 0x165, script: 0x5a, flags: 0x0}, + 554: {region: 0x4f, script: 0x5a, flags: 0x0}, + 555: {region: 0x99, script: 0x22, flags: 0x0}, + 556: {region: 0x99, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5a, flags: 0x0}, + 558: {region: 0x95, script: 0x5a, flags: 0x0}, + 559: {region: 0x165, script: 0x5a, flags: 0x0}, + 560: {region: 0x41, script: 0x5a, flags: 0x0}, + 561: {region: 0x99, script: 0x5a, flags: 0x0}, + 562: {region: 0x53, script: 0xe2, flags: 0x0}, + 563: {region: 0x99, script: 0x22, flags: 0x0}, + 564: {region: 0xc3, script: 0x5a, flags: 0x0}, + 565: {region: 0x165, script: 0x5a, flags: 0x0}, + 566: {region: 0x99, script: 0x75, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x5a, flags: 0x0}, + 569: {region: 0xa4, script: 0x5a, flags: 0x0}, + 570: {region: 0x165, script: 0x5a, flags: 0x0}, + 571: {region: 0x12b, script: 0x5a, flags: 0x0}, + 572: {region: 0x165, script: 0x5a, flags: 0x0}, + 573: {region: 0xd2, script: 0x5a, flags: 0x0}, + 574: {region: 0x165, script: 0x5a, flags: 0x0}, + 575: {region: 0xaf, script: 0x57, flags: 0x0}, + 576: {region: 0x165, script: 0x5a, flags: 0x0}, + 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x5a, flags: 0x0}, + 580: {region: 0x52, script: 0x5a, flags: 0x0}, + 581: {region: 0x82, script: 0x5a, flags: 0x0}, + 582: {region: 0xa4, script: 0x5a, flags: 0x0}, + 583: {region: 0x165, script: 0x5a, flags: 0x0}, + 584: {region: 0x165, script: 0x5a, flags: 0x0}, + 585: {region: 0x165, script: 0x5a, flags: 0x0}, + 586: {region: 0xa6, script: 0x4e, flags: 0x0}, + 587: {region: 0x2a, script: 0x5a, flags: 0x0}, + 588: {region: 0x165, script: 0x5a, flags: 0x0}, + 589: {region: 0x165, script: 0x5a, flags: 0x0}, + 590: {region: 0x165, script: 0x5a, flags: 0x0}, + 591: {region: 0x165, script: 0x5a, flags: 0x0}, + 592: {region: 0x165, script: 0x5a, flags: 0x0}, + 593: {region: 0x99, script: 0x52, flags: 0x0}, + 594: {region: 0x8b, script: 0x5a, flags: 0x0}, + 595: {region: 0x165, script: 0x5a, flags: 0x0}, + 596: {region: 0xab, script: 0x53, flags: 0x0}, + 597: {region: 0x106, script: 0x20, flags: 0x0}, + 598: {region: 0x99, script: 0x22, flags: 0x0}, + 599: {region: 0x165, script: 0x5a, flags: 0x0}, + 600: {region: 0x75, script: 0x5a, flags: 0x0}, + 601: {region: 0x165, script: 0x5a, flags: 0x0}, + 602: {region: 0xb4, script: 0x5a, flags: 0x0}, + 603: {region: 0x165, script: 0x5a, flags: 0x0}, + 604: {region: 0x165, script: 0x5a, flags: 0x0}, + 605: {region: 0x165, script: 0x5a, flags: 0x0}, + 606: {region: 0x165, script: 0x5a, flags: 0x0}, + 607: {region: 0x165, script: 0x5a, flags: 0x0}, + 608: {region: 0x165, script: 0x5a, flags: 0x0}, + 609: {region: 0x165, script: 0x5a, flags: 0x0}, + 610: {region: 0x165, script: 0x2c, flags: 0x0}, + 611: {region: 0x165, script: 0x5a, flags: 0x0}, + 612: {region: 0x106, script: 0x20, flags: 0x0}, + 613: {region: 0x112, script: 0x5a, flags: 0x0}, + 614: {region: 0xe7, script: 0x5a, flags: 0x0}, + 615: {region: 0x106, script: 0x5a, flags: 0x0}, + 616: {region: 0x165, script: 0x5a, flags: 0x0}, + 617: {region: 0x99, script: 0x22, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x5a, flags: 0x0}, + 620: {region: 0x165, script: 0x5a, flags: 0x0}, + 621: {region: 0x52, script: 0x5a, flags: 0x0}, + 622: {region: 0x60, script: 0x5a, flags: 0x0}, + 623: {region: 0x165, script: 0x5a, flags: 0x0}, + 624: {region: 0x165, script: 0x5a, flags: 0x0}, + 625: {region: 0x165, script: 0x2c, flags: 0x0}, + 626: {region: 0x165, script: 0x5a, flags: 0x0}, + 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x5a, flags: 0x0}, + 630: {region: 0x165, script: 0x5a, flags: 0x0}, + 631: {region: 0x165, script: 0x5a, flags: 0x0}, + 632: {region: 0x165, script: 0x5a, flags: 0x0}, + 633: {region: 0x106, script: 0x20, flags: 0x0}, + 634: {region: 0x165, script: 0x5a, flags: 0x0}, + 635: {region: 0x165, script: 0x5a, flags: 0x0}, + 636: {region: 0x165, script: 0x5a, flags: 0x0}, + 637: {region: 0x106, script: 0x20, flags: 0x0}, + 638: {region: 0x165, script: 0x5a, flags: 0x0}, + 639: {region: 0x95, script: 0x5a, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x5a, flags: 0x0}, + 642: {region: 0x165, script: 0x5a, flags: 0x0}, + 643: {region: 0x165, script: 0x5a, flags: 0x0}, + 644: {region: 0x165, script: 0x5a, flags: 0x0}, + 645: {region: 0x165, script: 0x2c, flags: 0x0}, + 646: {region: 0x123, script: 0xeb, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x5a, flags: 0x0}, + 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x5a, flags: 0x0}, + 652: {region: 0x165, script: 0x5a, flags: 0x0}, + 653: {region: 0x165, script: 0x5a, flags: 0x0}, + 654: {region: 0x138, script: 0x5a, flags: 0x0}, + 655: {region: 0x87, script: 0x5e, flags: 0x0}, + 656: {region: 0x97, script: 0x3e, flags: 0x0}, + 657: {region: 0x12f, script: 0x5a, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x5a, flags: 0x0}, + 660: {region: 0x165, script: 0x5a, flags: 0x0}, + 661: {region: 0xb7, script: 0x5a, flags: 0x0}, + 662: {region: 0x106, script: 0x20, flags: 0x0}, + 663: {region: 0x165, script: 0x5a, flags: 0x0}, + 664: {region: 0x95, script: 0x5a, flags: 0x0}, + 665: {region: 0x165, script: 0x5a, flags: 0x0}, + 666: {region: 0x53, script: 0xeb, flags: 0x0}, + 667: {region: 0x165, script: 0x5a, flags: 0x0}, + 668: {region: 0x165, script: 0x5a, flags: 0x0}, + 669: {region: 0x165, script: 0x5a, flags: 0x0}, + 670: {region: 0x165, script: 0x5a, flags: 0x0}, + 671: {region: 0x99, script: 0x5c, flags: 0x0}, + 672: {region: 0x165, script: 0x5a, flags: 0x0}, + 673: {region: 0x165, script: 0x5a, flags: 0x0}, + 674: {region: 0x106, script: 0x20, flags: 0x0}, + 675: {region: 0x131, script: 0x5a, flags: 0x0}, + 676: {region: 0x165, script: 0x5a, flags: 0x0}, + 677: {region: 0xd9, script: 0x5a, flags: 0x0}, + 678: {region: 0x165, script: 0x5a, flags: 0x0}, + 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x5a, flags: 0x0}, + 682: {region: 0x165, script: 0x5a, flags: 0x0}, + 683: {region: 0x9e, script: 0x5a, flags: 0x0}, + 684: {region: 0x53, script: 0x60, flags: 0x0}, + 685: {region: 0x95, script: 0x5a, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x5a, flags: 0x0}, + 688: {region: 0x165, script: 0x5a, flags: 0x0}, + 689: {region: 0x165, script: 0x5a, flags: 0x0}, + 690: {region: 0x99, script: 0xe6, flags: 0x0}, + 691: {region: 0x9e, script: 0x5a, flags: 0x0}, + 692: {region: 0x165, script: 0x5a, flags: 0x0}, + 693: {region: 0x4b, script: 0x5a, flags: 0x0}, + 694: {region: 0x165, script: 0x5a, flags: 0x0}, + 695: {region: 0x165, script: 0x5a, flags: 0x0}, + 696: {region: 0xaf, script: 0x57, flags: 0x0}, + 697: {region: 0x165, script: 0x5a, flags: 0x0}, + 698: {region: 0x165, script: 0x5a, flags: 0x0}, + 699: {region: 0x4b, script: 0x5a, flags: 0x0}, + 700: {region: 0x165, script: 0x5a, flags: 0x0}, + 701: {region: 0x165, script: 0x5a, flags: 0x0}, + 702: {region: 0x162, script: 0x5a, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x5a, flags: 0x0}, + 705: {region: 0xb8, script: 0x5a, flags: 0x0}, + 706: {region: 0x4b, script: 0x5a, flags: 0x0}, + 707: {region: 0x4b, script: 0x5a, flags: 0x0}, + 708: {region: 0xa4, script: 0x5a, flags: 0x0}, + 709: {region: 0xa4, script: 0x5a, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x5a, flags: 0x0}, + 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12b, script: 0x5a, flags: 0x0}, + 715: {region: 0x95, script: 0x5a, flags: 0x0}, + 716: {region: 0x52, script: 0x5a, flags: 0x0}, + 717: {region: 0x99, script: 0x22, flags: 0x0}, + 718: {region: 0x99, script: 0x22, flags: 0x0}, + 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x5a, flags: 0x0}, + 722: {region: 0x165, script: 0x5a, flags: 0x0}, + 723: {region: 0xcf, script: 0x5a, flags: 0x0}, + 724: {region: 0x165, script: 0x5a, flags: 0x0}, + 725: {region: 0x165, script: 0x5a, flags: 0x0}, + 726: {region: 0x165, script: 0x5a, flags: 0x0}, + 727: {region: 0x165, script: 0x5a, flags: 0x0}, + 728: {region: 0x165, script: 0x5a, flags: 0x0}, + 729: {region: 0x165, script: 0x5a, flags: 0x0}, + 730: {region: 0x165, script: 0x5a, flags: 0x0}, + 731: {region: 0x165, script: 0x5a, flags: 0x0}, + 732: {region: 0x165, script: 0x5a, flags: 0x0}, + 733: {region: 0x165, script: 0x5a, flags: 0x0}, + 734: {region: 0x165, script: 0x5a, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x20, flags: 0x0}, + 737: {region: 0xe7, script: 0x5a, flags: 0x0}, + 738: {region: 0x165, script: 0x5a, flags: 0x0}, + 739: {region: 0x95, script: 0x5a, flags: 0x0}, + 740: {region: 0x165, script: 0x2c, flags: 0x0}, + 741: {region: 0x165, script: 0x5a, flags: 0x0}, + 742: {region: 0x165, script: 0x5a, flags: 0x0}, + 743: {region: 0x165, script: 0x5a, flags: 0x0}, + 744: {region: 0x112, script: 0x5a, flags: 0x0}, + 745: {region: 0xa4, script: 0x5a, flags: 0x0}, + 746: {region: 0x165, script: 0x5a, flags: 0x0}, + 747: {region: 0x165, script: 0x5a, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x5a, flags: 0x0}, + 750: {region: 0x165, script: 0x5a, flags: 0x0}, + 751: {region: 0x165, script: 0x5a, flags: 0x0}, + 752: {region: 0x165, script: 0x5a, flags: 0x0}, + 753: {region: 0xbf, script: 0x5a, flags: 0x0}, + 754: {region: 0xd1, script: 0x5a, flags: 0x0}, + 755: {region: 0x165, script: 0x5a, flags: 0x0}, + 756: {region: 0x52, script: 0x5a, flags: 0x0}, + 757: {region: 0xdb, script: 0x22, flags: 0x0}, + 758: {region: 0x12f, script: 0x5a, flags: 0x0}, + 759: {region: 0xc0, script: 0x5a, flags: 0x0}, + 760: {region: 0x165, script: 0x5a, flags: 0x0}, + 761: {region: 0x165, script: 0x5a, flags: 0x0}, + 762: {region: 0xe0, script: 0x5a, flags: 0x0}, + 763: {region: 0x165, script: 0x5a, flags: 0x0}, + 764: {region: 0x95, script: 0x5a, flags: 0x0}, + 765: {region: 0x9b, script: 0x3d, flags: 0x0}, + 766: {region: 0x165, script: 0x5a, flags: 0x0}, + 767: {region: 0xc2, script: 0x20, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x5a, flags: 0x0}, + 770: {region: 0x165, script: 0x5a, flags: 0x0}, + 771: {region: 0x165, script: 0x5a, flags: 0x0}, + 772: {region: 0x99, script: 0x6e, flags: 0x0}, + 773: {region: 0x165, script: 0x5a, flags: 0x0}, + 774: {region: 0x165, script: 0x5a, flags: 0x0}, + 775: {region: 0x10b, script: 0x5a, flags: 0x0}, + 776: {region: 0x165, script: 0x5a, flags: 0x0}, + 777: {region: 0x165, script: 0x5a, flags: 0x0}, + 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x5a, flags: 0x0}, + 781: {region: 0x165, script: 0x5a, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x75, flags: 0x0}, + 785: {region: 0x165, script: 0x5a, flags: 0x0}, + 786: {region: 0x49, script: 0x5a, flags: 0x0}, + 787: {region: 0x49, script: 0x5a, flags: 0x0}, + 788: {region: 0x37, script: 0x5a, flags: 0x0}, + 789: {region: 0x165, script: 0x5a, flags: 0x0}, + 790: {region: 0x165, script: 0x5a, flags: 0x0}, + 791: {region: 0x165, script: 0x5a, flags: 0x0}, + 792: {region: 0x165, script: 0x5a, flags: 0x0}, + 793: {region: 0x165, script: 0x5a, flags: 0x0}, + 794: {region: 0x165, script: 0x5a, flags: 0x0}, + 795: {region: 0x99, script: 0x22, flags: 0x0}, + 796: {region: 0xdb, script: 0x22, flags: 0x0}, + 797: {region: 0x106, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x72, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x5a, flags: 0x0}, + 801: {region: 0x165, script: 0x5a, flags: 0x0}, + 802: {region: 0x165, script: 0x5a, flags: 0x0}, + 803: {region: 0x165, script: 0x5a, flags: 0x0}, + 804: {region: 0x99, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5a, flags: 0x0}, + 807: {region: 0x165, script: 0x5a, flags: 0x0}, + 808: {region: 0x135, script: 0x5a, flags: 0x0}, + 809: {region: 0x165, script: 0x5a, flags: 0x0}, + 810: {region: 0x165, script: 0x5a, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x5a, flags: 0x0}, + 813: {region: 0x99, script: 0x22, flags: 0x0}, + 814: {region: 0x95, script: 0x5a, flags: 0x0}, + 815: {region: 0x164, script: 0x5a, flags: 0x0}, + 816: {region: 0x165, script: 0x5a, flags: 0x0}, + 817: {region: 0xc4, script: 0x75, flags: 0x0}, + 818: {region: 0x165, script: 0x5a, flags: 0x0}, + 819: {region: 0x165, script: 0x2c, flags: 0x0}, + 820: {region: 0x106, script: 0x20, flags: 0x0}, + 821: {region: 0x165, script: 0x5a, flags: 0x0}, + 822: {region: 0x131, script: 0x5a, flags: 0x0}, + 823: {region: 0x9c, script: 0x66, flags: 0x0}, + 824: {region: 0x165, script: 0x5a, flags: 0x0}, + 825: {region: 0x165, script: 0x5a, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x5a, flags: 0x0}, + 828: {region: 0x165, script: 0x5a, flags: 0x0}, + 829: {region: 0x165, script: 0x5a, flags: 0x0}, + 830: {region: 0xdd, script: 0x5a, flags: 0x0}, + 831: {region: 0x165, script: 0x5a, flags: 0x0}, + 832: {region: 0x165, script: 0x5a, flags: 0x0}, + 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9e, script: 0x5a, flags: 0x0}, + 837: {region: 0xd2, script: 0x5a, flags: 0x0}, + 838: {region: 0x165, script: 0x5a, flags: 0x0}, + 839: {region: 0xda, script: 0x5a, flags: 0x0}, + 840: {region: 0x165, script: 0x5a, flags: 0x0}, + 841: {region: 0x165, script: 0x5a, flags: 0x0}, + 842: {region: 0x165, script: 0x5a, flags: 0x0}, + 843: {region: 0xcf, script: 0x5a, flags: 0x0}, + 844: {region: 0x165, script: 0x5a, flags: 0x0}, + 845: {region: 0x165, script: 0x5a, flags: 0x0}, + 846: {region: 0x164, script: 0x5a, flags: 0x0}, + 847: {region: 0xd1, script: 0x5a, flags: 0x0}, + 848: {region: 0x60, script: 0x5a, flags: 0x0}, + 849: {region: 0xdb, script: 0x22, flags: 0x0}, + 850: {region: 0x165, script: 0x5a, flags: 0x0}, + 851: {region: 0xdb, script: 0x22, flags: 0x0}, + 852: {region: 0x165, script: 0x5a, flags: 0x0}, + 853: {region: 0x165, script: 0x5a, flags: 0x0}, + 854: {region: 0xd2, script: 0x5a, flags: 0x0}, + 855: {region: 0x165, script: 0x5a, flags: 0x0}, + 856: {region: 0x165, script: 0x5a, flags: 0x0}, + 857: {region: 0xd1, script: 0x5a, flags: 0x0}, + 858: {region: 0x165, script: 0x5a, flags: 0x0}, + 859: {region: 0xcf, script: 0x5a, flags: 0x0}, + 860: {region: 0xcf, script: 0x5a, flags: 0x0}, + 861: {region: 0x165, script: 0x5a, flags: 0x0}, + 862: {region: 0x165, script: 0x5a, flags: 0x0}, + 863: {region: 0x95, script: 0x5a, flags: 0x0}, + 864: {region: 0x165, script: 0x5a, flags: 0x0}, + 865: {region: 0xdf, script: 0x5a, flags: 0x0}, + 866: {region: 0x165, script: 0x5a, flags: 0x0}, + 867: {region: 0x165, script: 0x5a, flags: 0x0}, + 868: {region: 0x99, script: 0x5a, flags: 0x0}, + 869: {region: 0x165, script: 0x5a, flags: 0x0}, + 870: {region: 0x165, script: 0x5a, flags: 0x0}, + 871: {region: 0xd9, script: 0x5a, flags: 0x0}, + 872: {region: 0x52, script: 0x5a, flags: 0x0}, + 873: {region: 0x165, script: 0x5a, flags: 0x0}, + 874: {region: 0xda, script: 0x5a, flags: 0x0}, + 875: {region: 0x165, script: 0x5a, flags: 0x0}, + 876: {region: 0x52, script: 0x5a, flags: 0x0}, + 877: {region: 0x165, script: 0x5a, flags: 0x0}, + 878: {region: 0x165, script: 0x5a, flags: 0x0}, + 879: {region: 0xda, script: 0x5a, flags: 0x0}, + 880: {region: 0x123, script: 0x56, flags: 0x0}, + 881: {region: 0x99, script: 0x22, flags: 0x0}, + 882: {region: 0x10c, script: 0xc9, flags: 0x0}, + 883: {region: 0x165, script: 0x5a, flags: 0x0}, + 884: {region: 0x165, script: 0x5a, flags: 0x0}, + 885: {region: 0x84, script: 0x7c, flags: 0x0}, + 886: {region: 0x161, script: 0x5a, flags: 0x0}, + 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x5a, flags: 0x0}, + 890: {region: 0x161, script: 0x5a, flags: 0x0}, + 891: {region: 0x165, script: 0x5a, flags: 0x0}, + 892: {region: 0x165, script: 0x5a, flags: 0x0}, + 893: {region: 0x165, script: 0x5a, flags: 0x0}, + 894: {region: 0x165, script: 0x5a, flags: 0x0}, + 895: {region: 0x165, script: 0x5a, flags: 0x0}, + 896: {region: 0x117, script: 0x5a, flags: 0x0}, + 897: {region: 0x165, script: 0x5a, flags: 0x0}, + 898: {region: 0x165, script: 0x5a, flags: 0x0}, + 899: {region: 0x135, script: 0x5a, flags: 0x0}, + 900: {region: 0x165, script: 0x5a, flags: 0x0}, + 901: {region: 0x53, script: 0x5a, flags: 0x0}, + 902: {region: 0x165, script: 0x5a, flags: 0x0}, + 903: {region: 0xce, script: 0x5a, flags: 0x0}, + 904: {region: 0x12f, script: 0x5a, flags: 0x0}, + 905: {region: 0x131, script: 0x5a, flags: 0x0}, + 906: {region: 0x80, script: 0x5a, flags: 0x0}, + 907: {region: 0x78, script: 0x5a, flags: 0x0}, + 908: {region: 0x165, script: 0x5a, flags: 0x0}, + 910: {region: 0x165, script: 0x5a, flags: 0x0}, + 911: {region: 0x165, script: 0x5a, flags: 0x0}, + 912: {region: 0x6f, script: 0x5a, flags: 0x0}, + 913: {region: 0x165, script: 0x5a, flags: 0x0}, + 914: {region: 0x165, script: 0x5a, flags: 0x0}, + 915: {region: 0x165, script: 0x5a, flags: 0x0}, + 916: {region: 0x165, script: 0x5a, flags: 0x0}, + 917: {region: 0x99, script: 0x81, flags: 0x0}, + 918: {region: 0x165, script: 0x5a, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x20, flags: 0x0}, + 921: {region: 0x135, script: 0x82, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x80, flags: 0x0}, + 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x5a, flags: 0x0}, + 929: {region: 0x30, script: 0x5a, flags: 0x0}, + 930: {region: 0xf0, script: 0x5a, flags: 0x0}, + 931: {region: 0x165, script: 0x5a, flags: 0x0}, + 932: {region: 0x78, script: 0x5a, flags: 0x0}, + 933: {region: 0xd6, script: 0x5a, flags: 0x0}, + 934: {region: 0x135, script: 0x5a, flags: 0x0}, + 935: {region: 0x49, script: 0x5a, flags: 0x0}, + 936: {region: 0x165, script: 0x5a, flags: 0x0}, + 937: {region: 0x9c, script: 0xf7, flags: 0x0}, + 938: {region: 0x165, script: 0x5a, flags: 0x0}, + 939: {region: 0x60, script: 0x5a, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x8e, flags: 0x0}, + 943: {region: 0x165, script: 0x5a, flags: 0x0}, + 944: {region: 0x165, script: 0x5a, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x5a, flags: 0x0}, + 947: {region: 0xe9, script: 0x5a, flags: 0x0}, + 948: {region: 0x165, script: 0x5a, flags: 0x0}, + 949: {region: 0x9e, script: 0x5a, flags: 0x0}, + 950: {region: 0x165, script: 0x5a, flags: 0x0}, + 951: {region: 0x165, script: 0x5a, flags: 0x0}, + 952: {region: 0x87, script: 0x34, flags: 0x0}, + 953: {region: 0x75, script: 0x5a, flags: 0x0}, + 954: {region: 0x165, script: 0x5a, flags: 0x0}, + 955: {region: 0xe8, script: 0x4d, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x5a, flags: 0x0}, + 960: {region: 0x41, script: 0x5a, flags: 0x0}, + 961: {region: 0x165, script: 0x5a, flags: 0x0}, + 962: {region: 0x7a, script: 0x5a, flags: 0x0}, + 963: {region: 0x165, script: 0x5a, flags: 0x0}, + 964: {region: 0xe4, script: 0x5a, flags: 0x0}, + 965: {region: 0x89, script: 0x5a, flags: 0x0}, + 966: {region: 0x69, script: 0x5a, flags: 0x0}, + 967: {region: 0x165, script: 0x5a, flags: 0x0}, + 968: {region: 0x99, script: 0x22, flags: 0x0}, + 969: {region: 0x165, script: 0x5a, flags: 0x0}, + 970: {region: 0x102, script: 0x5a, flags: 0x0}, + 971: {region: 0x95, script: 0x5a, flags: 0x0}, + 972: {region: 0x165, script: 0x5a, flags: 0x0}, + 973: {region: 0x165, script: 0x5a, flags: 0x0}, + 974: {region: 0x9e, script: 0x5a, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5a, flags: 0x0}, + 981: {region: 0x72, script: 0x5a, flags: 0x0}, + 982: {region: 0x4e, script: 0x5a, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x5a, flags: 0x0}, + 985: {region: 0x3a, script: 0x5a, flags: 0x0}, + 986: {region: 0x165, script: 0x5a, flags: 0x0}, + 987: {region: 0xd1, script: 0x5a, flags: 0x0}, + 988: {region: 0x104, script: 0x5a, flags: 0x0}, + 989: {region: 0x95, script: 0x5a, flags: 0x0}, + 990: {region: 0x12f, script: 0x5a, flags: 0x0}, + 991: {region: 0x165, script: 0x5a, flags: 0x0}, + 992: {region: 0x165, script: 0x5a, flags: 0x0}, + 993: {region: 0x73, script: 0x5a, flags: 0x0}, + 994: {region: 0x106, script: 0x20, flags: 0x0}, + 995: {region: 0x130, script: 0x20, flags: 0x0}, + 996: {region: 0x109, script: 0x5a, flags: 0x0}, + 997: {region: 0x107, script: 0x5a, flags: 0x0}, + 998: {region: 0x12f, script: 0x5a, flags: 0x0}, + 999: {region: 0x165, script: 0x5a, flags: 0x0}, + 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, + 1001: {region: 0x99, script: 0x22, flags: 0x0}, + 1002: {region: 0x80, script: 0x5a, flags: 0x0}, + 1003: {region: 0x106, script: 0x20, flags: 0x0}, + 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, + 1005: {region: 0x95, script: 0x5a, flags: 0x0}, + 1006: {region: 0x99, script: 0x5a, flags: 0x0}, + 1007: {region: 0x114, script: 0x5a, flags: 0x0}, + 1008: {region: 0x99, script: 0xcd, flags: 0x0}, + 1009: {region: 0x165, script: 0x5a, flags: 0x0}, + 1010: {region: 0x165, script: 0x5a, flags: 0x0}, + 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1013: {region: 0x99, script: 0x22, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, + 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x5a, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, + 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, + 1027: {region: 0x96, script: 0x7e, flags: 0x0}, + 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, + 1029: {region: 0x165, script: 0x2c, flags: 0x0}, + 1030: {region: 0x165, script: 0x5a, flags: 0x0}, + 1032: {region: 0xba, script: 0xe8, flags: 0x0}, + 1033: {region: 0x165, script: 0x5a, flags: 0x0}, + 1034: {region: 0xc4, script: 0x75, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, + 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, + 1038: {region: 0x165, script: 0x5a, flags: 0x0}, + 1039: {region: 0x165, script: 0x5a, flags: 0x0}, + 1040: {region: 0x165, script: 0x5a, flags: 0x0}, + 1041: {region: 0x165, script: 0x5a, flags: 0x0}, + 1042: {region: 0x111, script: 0x5a, flags: 0x0}, + 1043: {region: 0x165, script: 0x5a, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x5a, flags: 0x0}, + 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, + 1047: {region: 0x165, script: 0x5a, flags: 0x0}, + 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1049: {region: 0x165, script: 0x5a, flags: 0x0}, + 1050: {region: 0x95, script: 0x5a, flags: 0x0}, + 1051: {region: 0x142, script: 0x5a, flags: 0x0}, + 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1055: {region: 0x72, script: 0x5a, flags: 0x0}, + 1056: {region: 0x97, script: 0xca, flags: 0x0}, + 1057: {region: 0x165, script: 0x5a, flags: 0x0}, + 1058: {region: 0x72, script: 0x5a, flags: 0x0}, + 1059: {region: 0x164, script: 0x5a, flags: 0x0}, + 1060: {region: 0x165, script: 0x5a, flags: 0x0}, + 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1062: {region: 0x165, script: 0x5a, flags: 0x0}, + 1063: {region: 0x165, script: 0x5a, flags: 0x0}, + 1064: {region: 0x165, script: 0x5a, flags: 0x0}, + 1065: {region: 0x115, script: 0x5a, flags: 0x0}, + 1066: {region: 0x165, script: 0x5a, flags: 0x0}, + 1067: {region: 0x165, script: 0x5a, flags: 0x0}, + 1068: {region: 0x123, script: 0xeb, flags: 0x0}, + 1069: {region: 0x165, script: 0x5a, flags: 0x0}, + 1070: {region: 0x165, script: 0x5a, flags: 0x0}, + 1071: {region: 0x165, script: 0x5a, flags: 0x0}, + 1072: {region: 0x165, script: 0x5a, flags: 0x0}, + 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xd7, flags: 0x0}, + 1076: {region: 0x116, script: 0x5a, flags: 0x0}, + 1077: {region: 0x114, script: 0x5a, flags: 0x0}, + 1078: {region: 0x99, script: 0x22, flags: 0x0}, + 1079: {region: 0x161, script: 0x5a, flags: 0x0}, + 1080: {region: 0x165, script: 0x5a, flags: 0x0}, + 1081: {region: 0x165, script: 0x5a, flags: 0x0}, + 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, + 1083: {region: 0x161, script: 0x5a, flags: 0x0}, + 1084: {region: 0x165, script: 0x5a, flags: 0x0}, + 1085: {region: 0x60, script: 0x5a, flags: 0x0}, + 1086: {region: 0x95, script: 0x5a, flags: 0x0}, + 1087: {region: 0x165, script: 0x5a, flags: 0x0}, + 1088: {region: 0x165, script: 0x5a, flags: 0x0}, + 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1090: {region: 0x165, script: 0x5a, flags: 0x0}, + 1091: {region: 0x84, script: 0x5a, flags: 0x0}, + 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, + 1096: {region: 0x60, script: 0x5a, flags: 0x0}, + 1097: {region: 0x165, script: 0x5a, flags: 0x0}, + 1098: {region: 0x99, script: 0x22, flags: 0x0}, + 1099: {region: 0x95, script: 0x5a, flags: 0x0}, + 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, + 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1104: {region: 0x99, script: 0xe3, flags: 0x0}, + 1105: {region: 0xdb, script: 0x22, flags: 0x0}, + 1106: {region: 0x165, script: 0x5a, flags: 0x0}, + 1107: {region: 0x165, script: 0x5a, flags: 0x0}, + 1108: {region: 0x165, script: 0x5a, flags: 0x0}, + 1109: {region: 0x165, script: 0x5a, flags: 0x0}, + 1110: {region: 0x165, script: 0x5a, flags: 0x0}, + 1111: {region: 0x165, script: 0x5a, flags: 0x0}, + 1112: {region: 0x165, script: 0x5a, flags: 0x0}, + 1113: {region: 0x165, script: 0x5a, flags: 0x0}, + 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1115: {region: 0x165, script: 0x5a, flags: 0x0}, + 1116: {region: 0x165, script: 0x5a, flags: 0x0}, + 1117: {region: 0x99, script: 0x52, flags: 0x0}, + 1118: {region: 0x53, script: 0xe1, flags: 0x0}, + 1119: {region: 0xdb, script: 0x22, flags: 0x0}, + 1120: {region: 0xdb, script: 0x22, flags: 0x0}, + 1121: {region: 0x99, script: 0xe6, flags: 0x0}, + 1122: {region: 0x165, script: 0x5a, flags: 0x0}, + 1123: {region: 0x112, script: 0x5a, flags: 0x0}, + 1124: {region: 0x131, script: 0x5a, flags: 0x0}, + 1125: {region: 0x126, script: 0x5a, flags: 0x0}, + 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x5a, flags: 0x0}, + 1129: {region: 0x165, script: 0x5a, flags: 0x0}, + 1130: {region: 0x165, script: 0x5a, flags: 0x0}, + 1131: {region: 0x123, script: 0xeb, flags: 0x0}, + 1132: {region: 0xdb, script: 0x22, flags: 0x0}, + 1133: {region: 0xdb, script: 0x22, flags: 0x0}, + 1134: {region: 0xdb, script: 0x22, flags: 0x0}, + 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1136: {region: 0x165, script: 0x5a, flags: 0x0}, + 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, + 1138: {region: 0x165, script: 0x5a, flags: 0x0}, + 1139: {region: 0x165, script: 0x5a, flags: 0x0}, + 1140: {region: 0x165, script: 0x5a, flags: 0x0}, + 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1142: {region: 0x127, script: 0x5a, flags: 0x0}, + 1143: {region: 0x125, script: 0x5a, flags: 0x0}, + 1144: {region: 0x32, script: 0x5a, flags: 0x0}, + 1145: {region: 0xdb, script: 0x22, flags: 0x0}, + 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1147: {region: 0x165, script: 0x5a, flags: 0x0}, + 1148: {region: 0x165, script: 0x5a, flags: 0x0}, + 1149: {region: 0x32, script: 0x5a, flags: 0x0}, + 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1151: {region: 0x165, script: 0x5a, flags: 0x0}, + 1152: {region: 0x161, script: 0x5a, flags: 0x0}, + 1153: {region: 0x165, script: 0x5a, flags: 0x0}, + 1154: {region: 0x129, script: 0x5a, flags: 0x0}, + 1155: {region: 0x165, script: 0x5a, flags: 0x0}, + 1156: {region: 0xce, script: 0x5a, flags: 0x0}, + 1157: {region: 0x165, script: 0x5a, flags: 0x0}, + 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, + 1159: {region: 0x165, script: 0x5a, flags: 0x0}, + 1160: {region: 0x165, script: 0x5a, flags: 0x0}, + 1161: {region: 0x165, script: 0x5a, flags: 0x0}, + 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x5a, flags: 0x0}, + 1167: {region: 0x87, script: 0x34, flags: 0x0}, + 1168: {region: 0xdb, script: 0x22, flags: 0x0}, + 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1170: {region: 0x43, script: 0xec, flags: 0x0}, + 1171: {region: 0x165, script: 0x5a, flags: 0x0}, + 1172: {region: 0x106, script: 0x20, flags: 0x0}, + 1173: {region: 0x165, script: 0x5a, flags: 0x0}, + 1174: {region: 0x165, script: 0x5a, flags: 0x0}, + 1175: {region: 0x131, script: 0x5a, flags: 0x0}, + 1176: {region: 0x165, script: 0x5a, flags: 0x0}, + 1177: {region: 0x123, script: 0xeb, flags: 0x0}, + 1178: {region: 0x32, script: 0x5a, flags: 0x0}, + 1179: {region: 0x165, script: 0x5a, flags: 0x0}, + 1180: {region: 0x165, script: 0x5a, flags: 0x0}, + 1181: {region: 0xce, script: 0x5a, flags: 0x0}, + 1182: {region: 0x165, script: 0x5a, flags: 0x0}, + 1183: {region: 0x165, script: 0x5a, flags: 0x0}, + 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, + 1185: {region: 0x165, script: 0x5a, flags: 0x0}, + 1187: {region: 0x165, script: 0x5a, flags: 0x0}, + 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1189: {region: 0x53, script: 0xe4, flags: 0x0}, + 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, + 1191: {region: 0x165, script: 0x5a, flags: 0x0}, + 1192: {region: 0x106, script: 0x20, flags: 0x0}, + 1193: {region: 0xba, script: 0x5a, flags: 0x0}, + 1194: {region: 0x165, script: 0x5a, flags: 0x0}, + 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, + 1198: {region: 0x130, script: 0x20, flags: 0x0}, + 1199: {region: 0x75, script: 0x5a, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x5a, flags: 0x0}, + 1206: {region: 0x165, script: 0x5a, flags: 0x0}, + 1207: {region: 0x165, script: 0x5a, flags: 0x0}, + 1208: {region: 0x165, script: 0x5a, flags: 0x0}, + 1209: {region: 0x165, script: 0x5a, flags: 0x0}, + 1210: {region: 0x165, script: 0x5a, flags: 0x0}, + 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x5a, flags: 0x0}, + 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, + 1215: {region: 0x165, script: 0x5a, flags: 0x0}, + 1216: {region: 0x161, script: 0x5a, flags: 0x0}, + 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1218: {region: 0x106, script: 0x5a, flags: 0x0}, + 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, + 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, + 1221: {region: 0x165, script: 0x5a, flags: 0x0}, + 1222: {region: 0x36, script: 0x5a, flags: 0x0}, + 1223: {region: 0x60, script: 0x5a, flags: 0x0}, + 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1225: {region: 0x1, script: 0x5a, flags: 0x0}, + 1226: {region: 0x106, script: 0x5a, flags: 0x0}, + 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, + 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1229: {region: 0x165, script: 0x5a, flags: 0x0}, + 1230: {region: 0x36, script: 0x5a, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, + 1232: {region: 0x165, script: 0x5a, flags: 0x0}, + 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1234: {region: 0x165, script: 0x5a, flags: 0x0}, + 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, + 1237: {region: 0x99, script: 0xe6, flags: 0x0}, + 1238: {region: 0x99, script: 0x22, flags: 0x0}, + 1239: {region: 0x165, script: 0x5a, flags: 0x0}, + 1240: {region: 0x165, script: 0x5a, flags: 0x0}, + 1241: {region: 0x165, script: 0x5a, flags: 0x0}, + 1242: {region: 0x165, script: 0x5a, flags: 0x0}, + 1243: {region: 0x165, script: 0x5a, flags: 0x0}, + 1244: {region: 0x165, script: 0x5a, flags: 0x0}, + 1245: {region: 0x165, script: 0x5a, flags: 0x0}, + 1246: {region: 0x165, script: 0x5a, flags: 0x0}, + 1247: {region: 0x165, script: 0x5a, flags: 0x0}, + 1248: {region: 0x140, script: 0x5a, flags: 0x0}, + 1249: {region: 0x165, script: 0x5a, flags: 0x0}, + 1250: {region: 0x165, script: 0x5a, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x5a, flags: 0x0}, + 1253: {region: 0x114, script: 0x5a, flags: 0x0}, + 1254: {region: 0x165, script: 0x5a, flags: 0x0}, + 1255: {region: 0x165, script: 0x5a, flags: 0x0}, + 1256: {region: 0x165, script: 0x5a, flags: 0x0}, + 1257: {region: 0x165, script: 0x5a, flags: 0x0}, + 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x165, script: 0x5a, flags: 0x0}, + 1261: {region: 0x165, script: 0x5a, flags: 0x0}, + 1262: {region: 0x41, script: 0x5a, flags: 0x0}, + 1263: {region: 0x165, script: 0x5a, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x5a, flags: 0x0}, + 1266: {region: 0x161, script: 0x5a, flags: 0x0}, + 1267: {region: 0x165, script: 0x5a, flags: 0x0}, + 1268: {region: 0x12b, script: 0x62, flags: 0x0}, + 1269: {region: 0x12b, script: 0x63, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x67, flags: 0x0}, + 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, + 1273: {region: 0x108, script: 0x77, flags: 0x0}, + 1274: {region: 0x99, script: 0x22, flags: 0x0}, + 1275: {region: 0x131, script: 0x5a, flags: 0x0}, + 1276: {region: 0x165, script: 0x5a, flags: 0x0}, + 1277: {region: 0x9c, script: 0x91, flags: 0x0}, + 1278: {region: 0x165, script: 0x5a, flags: 0x0}, + 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, + 1280: {region: 0x165, script: 0x5a, flags: 0x0}, + 1281: {region: 0x165, script: 0x5a, flags: 0x0}, + 1282: {region: 0xdb, script: 0x22, flags: 0x0}, + 1283: {region: 0x165, script: 0x5a, flags: 0x0}, + 1284: {region: 0x165, script: 0x5a, flags: 0x0}, + 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1286: {region: 0x75, script: 0x5a, flags: 0x0}, + 1287: {region: 0x165, script: 0x5a, flags: 0x0}, + 1288: {region: 0x165, script: 0x5a, flags: 0x0}, + 1289: {region: 0x52, script: 0x5a, flags: 0x0}, + 1290: {region: 0x165, script: 0x5a, flags: 0x0}, + 1291: {region: 0x165, script: 0x5a, flags: 0x0}, + 1292: {region: 0x165, script: 0x5a, flags: 0x0}, + 1293: {region: 0x52, script: 0x5a, flags: 0x0}, + 1294: {region: 0x165, script: 0x5a, flags: 0x0}, + 1295: {region: 0x165, script: 0x5a, flags: 0x0}, + 1296: {region: 0x165, script: 0x5a, flags: 0x0}, + 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x165, script: 0x5a, flags: 0x0}, + 1300: {region: 0x165, script: 0x5a, flags: 0x0}, + 1301: {region: 0x165, script: 0x5a, flags: 0x0}, + 1302: {region: 0x165, script: 0x5a, flags: 0x0}, + 1303: {region: 0x165, script: 0x5a, flags: 0x0}, + 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1305: {region: 0x165, script: 0x5a, flags: 0x0}, + 1306: {region: 0x165, script: 0x5a, flags: 0x0}, + 1307: {region: 0x165, script: 0x5a, flags: 0x0}, + 1308: {region: 0x41, script: 0x5a, flags: 0x0}, + 1309: {region: 0x165, script: 0x5a, flags: 0x0}, + 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x5a, flags: 0x0}, + 1313: {region: 0x165, script: 0x5a, flags: 0x0}, + 1314: {region: 0x165, script: 0x5a, flags: 0x0}, + 1315: {region: 0x53, script: 0x5a, flags: 0x0}, + 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, + 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7d, flags: 0x0}, + 1323: {region: 0x165, script: 0x5a, flags: 0x0}, + 1324: {region: 0x122, script: 0x5a, flags: 0x0}, + 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, + 1326: {region: 0x165, script: 0x5a, flags: 0x0}, + 1327: {region: 0x161, script: 0x5a, flags: 0x0}, + 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x78, flags: 0x2}, + 2: {region: 0x11c, script: 0x85, flags: 0x2}, + 3: {region: 0x32, script: 0x5a, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x20, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x135, script: 0x5a, flags: 0x0}, + 11: {region: 0x7b, script: 0xcf, flags: 0x2}, + 12: {region: 0x114, script: 0x5a, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1f, flags: 0x0}, + 15: {region: 0x87, script: 0x5f, flags: 0x2}, + 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x5a, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x5a, flags: 0x2}, + 33: {region: 0xdb, script: 0x22, flags: 0x0}, + 34: {region: 0x99, script: 0x5d, flags: 0x2}, + 35: {region: 0x83, script: 0x5a, flags: 0x0}, + 36: {region: 0x84, script: 0x7c, flags: 0x4}, + 37: {region: 0x84, script: 0x7c, flags: 0x2}, + 38: {region: 0xc5, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x70, flags: 0x4}, + 40: {region: 0x53, script: 0x70, flags: 0x2}, + 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x36, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x8b, flags: 0x0}, + 48: {region: 0x53, script: 0x8c, flags: 0x2}, + 49: {region: 0xba, script: 0xe8, flags: 0x0}, + 50: {region: 0xd9, script: 0x5a, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x22, flags: 0x2}, + 53: {region: 0x99, script: 0x4f, flags: 0x2}, + 54: {region: 0x99, script: 0xd3, flags: 0x2}, + 55: {region: 0x105, script: 0x20, flags: 0x0}, + 56: {region: 0xbd, script: 0x5a, flags: 0x4}, + 57: {region: 0x104, script: 0x5a, flags: 0x4}, + 58: {region: 0x106, script: 0x5a, flags: 0x4}, + 59: {region: 0x12b, script: 0x5a, flags: 0x4}, + 60: {region: 0x124, script: 0x20, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x20, flags: 0x4}, + 65: {region: 0xc5, script: 0x20, flags: 0x4}, + 66: {region: 0xae, script: 0x20, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x22, flags: 0x4}, + 69: {region: 0xdb, script: 0x22, flags: 0x2}, + 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7b, script: 0x3c, flags: 0x4}, + 81: {region: 0x7e, script: 0x3c, flags: 0x4}, + 82: {region: 0x8d, script: 0x3c, flags: 0x4}, + 83: {region: 0x95, script: 0x3c, flags: 0x4}, + 84: {region: 0xc6, script: 0x3c, flags: 0x4}, + 85: {region: 0xd0, script: 0x3c, flags: 0x4}, + 86: {region: 0xe2, script: 0x3c, flags: 0x4}, + 87: {region: 0xe5, script: 0x3c, flags: 0x4}, + 88: {region: 0xe7, script: 0x3c, flags: 0x4}, + 89: {region: 0x116, script: 0x3c, flags: 0x4}, + 90: {region: 0x123, script: 0x3c, flags: 0x4}, + 91: {region: 0x12e, script: 0x3c, flags: 0x4}, + 92: {region: 0x135, script: 0x3c, flags: 0x4}, + 93: {region: 0x13e, script: 0x3c, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x37, flags: 0x2}, + 96: {region: 0x12e, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2148 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 43: {lang: 0x0, script: 0x5a, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 48: {lang: 0x367, script: 0x5a, flags: 0x0}, + 49: {lang: 0x444, script: 0x5a, flags: 0x0}, + 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5a, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5a, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 85: {lang: 0x0, script: 0x5a, flags: 0x0}, + 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, + 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 98: {lang: 0x1, script: 0x5a, flags: 0x0}, + 99: {lang: 0x101, script: 0x5a, flags: 0x0}, + 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 106: {lang: 0x140, script: 0x5a, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 114: {lang: 0x151, script: 0x5a, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 118: {lang: 0x158, script: 0x5a, flags: 0x0}, + 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 128: {lang: 0x21, script: 0x5a, flags: 0x0}, + 130: {lang: 0x245, script: 0x5a, flags: 0x0}, + 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x5a, flags: 0x0}, + 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 141: {lang: 0x529, script: 0x3c, flags: 0x0}, + 142: {lang: 0x0, script: 0x5a, flags: 0x0}, + 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, + 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x49, flags: 0x0}, + 164: {lang: 0x445, script: 0x5a, flags: 0x0}, + 165: {lang: 0x28a, script: 0x20, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x53, flags: 0x0}, + 171: {lang: 0x254, script: 0x53, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, + 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, + 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x5a, flags: 0x0}, + 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x5a, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xea, flags: 0x0}, + 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 210: {lang: 0x16, script: 0x5a, flags: 0x0}, + 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 217: {lang: 0x367, script: 0x5a, flags: 0x0}, + 218: {lang: 0x347, script: 0x5a, flags: 0x0}, + 219: {lang: 0x351, script: 0x22, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 230: {lang: 0x486, script: 0x5a, flags: 0x0}, + 231: {lang: 0x153, script: 0x5a, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, + 241: {lang: 0x194, script: 0x5a, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x20, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x5a, flags: 0x0}, + 272: {lang: 0x347, script: 0x5a, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 277: {lang: 0x429, script: 0x5a, flags: 0x0}, + 278: {lang: 0x367, script: 0x5a, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x5a, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 295: {lang: 0x476, script: 0x5a, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x5a, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x5a, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x5a, flags: 0x0}, + 309: {lang: 0x512, script: 0x3e, flags: 0x2}, + 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, + 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, + 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x5a, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5a, flags: 0x0}, + 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5a, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5a, flags: 0x0}, + 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5a, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, + 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5a, flags: 0x0}, + 47: {lang: 0x331, script: 0x75, flags: 0x0}, + 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5a, flags: 0x0}, + 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x5a}, + 2: {lang: 0x139, region: 0x135, script: 0x5a}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, + 4: {lang: 0x139, region: 0x2f, script: 0x5a}, + 5: {lang: 0x139, region: 0xd6, script: 0x5a}, + 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, + 7: {lang: 0x445, region: 0x12f, script: 0x5a}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5a}, + 10: {lang: 0x139, region: 0x161, script: 0x5a}, + 11: {lang: 0x139, region: 0x135, script: 0x5a}, + 12: {lang: 0x139, region: 0x135, script: 0x5a}, + 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x99, script: 0x22}, + 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, + 18: {lang: 0x139, region: 0x2f, script: 0x5a}, + 19: {lang: 0x139, region: 0xe6, script: 0x5a}, + 20: {lang: 0x139, region: 0x8a, script: 0x5a}, + 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x20}, + 26: {lang: 0x3e2, region: 0x106, script: 0x20}, + 27: {lang: 0x139, region: 0x7b, script: 0x5a}, + 28: {lang: 0x10d, region: 0x60, script: 0x5a}, + 29: {lang: 0x139, region: 0xd6, script: 0x5a}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, + 31: {lang: 0x139, region: 0x9a, script: 0x5a}, + 32: {lang: 0x139, region: 0x7b, script: 0x5a}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 30244 bytes (29KiB); checksum: B6B15F30 diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 00000000..e7afd318 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 00000000..1cc004a6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See https://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 00000000..b5d34889 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 00000000..a24fd1a4 --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 00000000..212b77c9 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 00000000..289b3a36 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 00000000..ee45f494 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script or + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 00000000..4d57222e --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), err +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 00000000..34a732b6 --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 147 + _Qaai = 155 + _Qabx = 196 + _Zinh = 252 + _Zyyy = 257 + _Zzzz = 258 +) + +var regionToGroups = []uint8{ // 358 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, + 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + // Entry C0 - FF + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, + 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 382 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7b}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xee}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1472 bytes (1KiB); checksum: F86C669 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 00000000..42ea7926 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go index e4c08110..9d2ae547 100644 --- a/vendor/golang.org/x/text/unicode/bidi/core.go +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -193,14 +193,14 @@ func (p *paragraph) run() { // // At the end of this function: // -// - The member variable matchingPDI is set to point to the index of the -// matching PDI character for each isolate initiator character. If there is -// no matching PDI, it is set to the length of the input text. For other -// characters, it is set to -1. -// - The member variable matchingIsolateInitiator is set to point to the -// index of the matching isolate initiator character for each PDI character. -// If there is no matching isolate initiator, or the character is not a PDI, -// it is set to -1. +// - The member variable matchingPDI is set to point to the index of the +// matching PDI character for each isolate initiator character. If there is +// no matching PDI, it is set to the length of the input text. For other +// characters, it is set to -1. +// - The member variable matchingIsolateInitiator is set to point to the +// index of the matching isolate initiator character for each PDI character. +// If there is no matching isolate initiator, or the character is not a PDI, +// it is set to -1. func (p *paragraph) determineMatchingIsolates() { p.matchingPDI = make([]int, p.Len()) p.matchingIsolateInitiator = make([]int, p.Len()) @@ -435,7 +435,7 @@ func maxLevel(a, b level) level { } // Rule X10, second bullet: Determine the start-of-sequence (sos) and end-of-sequence (eos) types, -// either L or R, for each isolating run sequence. +// either L or R, for each isolating run sequence. func (p *paragraph) isolatingRunSequence(indexes []int) *isolatingRunSequence { length := len(indexes) types := make([]Class, length) @@ -495,9 +495,9 @@ func (s *isolatingRunSequence) resolveWeakTypes() { if t == NSM { s.types[i] = precedingCharacterType } else { - if t.in(LRI, RLI, FSI, PDI) { - precedingCharacterType = ON - } + // if t.in(LRI, RLI, FSI, PDI) { + // precedingCharacterType = ON + // } precedingCharacterType = t } } @@ -905,7 +905,7 @@ func (p *paragraph) getLevels(linebreaks []int) []level { // Lines are concatenated from left to right. So for example, the fifth // character from the left on the third line is // -// getReordering(linebreaks)[linebreaks[1] + 4] +// getReordering(linebreaks)[linebreaks[1] + 4] // // (linebreaks[1] is the position after the last character of the second // line, which is also the index of the first character on the third line, diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index 526c7033..d69ccb4f 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -110,10 +110,11 @@ func (p Properties) BoundaryAfter() bool { } // We pack quick check data in 4 bits: -// 5: Combines forward (0 == false, 1 == true) -// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) -// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. -// 1..0: Number of trailing non-starters. +// +// 5: Combines forward (0 == false, 1 == true) +// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) +// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. +// 1..0: Number of trailing non-starters. // // When all 4 bits are zero, the character is inert, meaning it is never // influenced by normalization. diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index 95efcf26..4747ad07 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -18,16 +18,17 @@ import ( // A Form denotes a canonical representation of Unicode code points. // The Unicode-defined normalization and equivalence forms are: // -// NFC Unicode Normalization Form C -// NFD Unicode Normalization Form D -// NFKC Unicode Normalization Form KC -// NFKD Unicode Normalization Form KD +// NFC Unicode Normalization Form C +// NFD Unicode Normalization Form D +// NFKC Unicode Normalization Form KC +// NFKD Unicode Normalization Form KD // // For a Form f, this documentation uses the notation f(x) to mean // the bytes or string x converted to the given form. // A position n in x is called a boundary if conversion to the form can // proceed independently on both sides: -// f(x) == append(f(x[0:n]), f(x[n:])...) +// +// f(x) == append(f(x[0:n]), f(x[n:])...) // // References: https://unicode.org/reports/tr15/ and // https://unicode.org/notes/tn5/. diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 96a130d3..9115ef25 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -7315,7 +7315,7 @@ const recompMapPacked = "" + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E - "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 @@ -7342,7 +7342,7 @@ const recompMapPacked = "" + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 - "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 diff --git a/vendor/golang.org/x/text/width/tables10.0.0.go b/vendor/golang.org/x/text/width/tables10.0.0.go index 186b1d4e..cd9d91ca 100644 --- a/vendor/golang.org/x/text/width/tables10.0.0.go +++ b/vendor/golang.org/x/text/width/tables10.0.0.go @@ -1146,21 +1146,31 @@ var widthIndex = [1408]uint8{ } // inverseData contains 4-byte entries of the following format: -// <0 padding> +// +// <0 padding> +// // The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the // UTF-8 encoding of the original rune. Mappings often have the following // pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// // By xor-ing the last byte the same entry can be shared by many mappings. This // reduces the total number of distinct entries by about two thirds. // The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } +// +// { 0x01, 0xE0, 0x00, 0x00 } +// // Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. +// +// E0 ^ A1 = 41. +// // Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. +// +// E0 ^ A2 = 42. +// // Note that because of the xor-ing, the byte sequence stored in the entry is // not valid UTF-8. var inverseData = [150][4]byte{ diff --git a/vendor/golang.org/x/text/width/tables11.0.0.go b/vendor/golang.org/x/text/width/tables11.0.0.go index 990f7622..327eaef9 100644 --- a/vendor/golang.org/x/text/width/tables11.0.0.go +++ b/vendor/golang.org/x/text/width/tables11.0.0.go @@ -1158,21 +1158,31 @@ var widthIndex = [1408]uint8{ } // inverseData contains 4-byte entries of the following format: -// <0 padding> +// +// <0 padding> +// // The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the // UTF-8 encoding of the original rune. Mappings often have the following // pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// // By xor-ing the last byte the same entry can be shared by many mappings. This // reduces the total number of distinct entries by about two thirds. // The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } +// +// { 0x01, 0xE0, 0x00, 0x00 } +// // Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. +// +// E0 ^ A1 = 41. +// // Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. +// +// E0 ^ A2 = 42. +// // Note that because of the xor-ing, the byte sequence stored in the entry is // not valid UTF-8. var inverseData = [150][4]byte{ diff --git a/vendor/golang.org/x/text/width/tables12.0.0.go b/vendor/golang.org/x/text/width/tables12.0.0.go index 85296297..5c14ade6 100644 --- a/vendor/golang.org/x/text/width/tables12.0.0.go +++ b/vendor/golang.org/x/text/width/tables12.0.0.go @@ -1178,21 +1178,31 @@ var widthIndex = [1408]uint8{ } // inverseData contains 4-byte entries of the following format: -// <0 padding> +// +// <0 padding> +// // The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the // UTF-8 encoding of the original rune. Mappings often have the following // pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// // By xor-ing the last byte the same entry can be shared by many mappings. This // reduces the total number of distinct entries by about two thirds. // The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } +// +// { 0x01, 0xE0, 0x00, 0x00 } +// // Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. +// +// E0 ^ A1 = 41. +// // Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. +// +// E0 ^ A2 = 42. +// // Note that because of the xor-ing, the byte sequence stored in the entry is // not valid UTF-8. var inverseData = [150][4]byte{ diff --git a/vendor/golang.org/x/text/width/tables13.0.0.go b/vendor/golang.org/x/text/width/tables13.0.0.go index bac3f1ae..ab258e38 100644 --- a/vendor/golang.org/x/text/width/tables13.0.0.go +++ b/vendor/golang.org/x/text/width/tables13.0.0.go @@ -1179,21 +1179,31 @@ var widthIndex = [1408]uint8{ } // inverseData contains 4-byte entries of the following format: -// <0 padding> +// +// <0 padding> +// // The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the // UTF-8 encoding of the original rune. Mappings often have the following // pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// // By xor-ing the last byte the same entry can be shared by many mappings. This // reduces the total number of distinct entries by about two thirds. // The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } +// +// { 0x01, 0xE0, 0x00, 0x00 } +// // Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. +// +// E0 ^ A1 = 41. +// // Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. +// +// E0 ^ A2 = 42. +// // Note that because of the xor-ing, the byte sequence stored in the entry is // not valid UTF-8. var inverseData = [150][4]byte{ diff --git a/vendor/golang.org/x/text/width/tables9.0.0.go b/vendor/golang.org/x/text/width/tables9.0.0.go index b3db84f6..6781f3d9 100644 --- a/vendor/golang.org/x/text/width/tables9.0.0.go +++ b/vendor/golang.org/x/text/width/tables9.0.0.go @@ -1114,21 +1114,31 @@ var widthIndex = [1408]uint8{ } // inverseData contains 4-byte entries of the following format: -// <0 padding> +// +// <0 padding> +// // The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the // UTF-8 encoding of the original rune. Mappings often have the following // pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... +// +// Ａ -> A (U+FF21 -> U+0041) +// Ｂ -> B (U+FF22 -> U+0042) +// ... +// // By xor-ing the last byte the same entry can be shared by many mappings. This // reduces the total number of distinct entries by about two thirds. // The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } +// +// { 0x01, 0xE0, 0x00, 0x00 } +// // Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. +// +// E0 ^ A1 = 41. +// // Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. +// +// E0 ^ A2 = 42. +// // Note that because of the xor-ing, the byte sequence stored in the entry is // not valid UTF-8. var inverseData = [150][4]byte{ diff --git a/vendor/modules.txt b/vendor/modules.txt index 9c286cb9..92ab67fb 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,4 +1,4 @@ -# github.com/AlecAivazis/survey/v2 v2.3.4 +# github.com/AlecAivazis/survey/v2 v2.3.7 ## explicit github.com/AlecAivazis/survey/v2 github.com/AlecAivazis/survey/v2/core @@ -211,7 +211,7 @@ github.com/ulikunitz/xz/internal/xlog github.com/ulikunitz/xz/lzma # github.com/xi2/xz v0.0.0-20171230120015-48954b6210f8 github.com/xi2/xz -# golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd +# golang.org/x/net v0.0.0-20220722155237-a158d28d115b golang.org/x/net/context golang.org/x/net/context/ctxhttp golang.org/x/net/http/httpguts @@ -222,14 +222,20 @@ golang.org/x/net/idna ## explicit golang.org/x/oauth2 golang.org/x/oauth2/internal -# golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e +# golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f golang.org/x/sys/internal/unsafeheader golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows # golang.org/x/term v0.0.0-20210927222741-03fcf44c2211 golang.org/x/term -# golang.org/x/text v0.3.7 +# golang.org/x/text v0.4.0 +golang.org/x/text/cases +golang.org/x/text/internal +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/tag +golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi