From da54f9273ce7da0751d5f079ad7fc4b02105125c Mon Sep 17 00:00:00 2001 From: fuyu-myk Date: Fri, 26 Jun 2026 10:35:37 +0800 Subject: [PATCH] Fix ring-closure encoding and decoding for molecules with >= 100 ring bonds --- safe/converter.py | 51 +++++++++++++++++++++++++++++++--------------- tests/test_safe.py | 37 +++++++++++++++++++++++++++++++++ 2 files changed, 72 insertions(+), 16 deletions(-) diff --git a/safe/converter.py b/safe/converter.py index e6ae217..8486877 100644 --- a/safe/converter.py +++ b/safe/converter.py @@ -105,6 +105,23 @@ def randomize(mol: dm.Mol, rng: Optional[int] = None): atom_indices = rng.permutation(atom_indices).tolist() return Chem.RenumberAtoms(mol, atom_indices) + @staticmethod + def _format_ring_closure(num: int) -> str: + """Format a ring-closure (branch) number into its SMILES token. + + Single digits stay bare (e.g. ``5``), two-digit numbers use the ``%NN`` + form, and numbers >= 100 use RDKit's extended ``%(nnn)`` ring-closure + notation (see https://www.rdkit.org/docs/RDKit_Book.html#ring-closures). + + Args: + num: ring-closure number to format + """ + if num < 10: + return str(num) + if num < 100: + return f"%{num}" + return f"%({num})" + @classmethod def _find_branch_number(cls, inp: str): """Find the branch number and ring closure in the SMILES representation using regexp @@ -113,16 +130,18 @@ def _find_branch_number(cls, inp: str): inp: input smiles """ inp = re.sub(r"\[.*?\]", "", inp) # noqa - matching_groups = re.findall(r"((?<=%)\d{2})|((?= 100; see `_format_ring_closure`. + # https://www.rdkit.org/docs/RDKit_Book.html#ring-closures branch_numbers = self._find_branch_number(inp) mol = dm.to_mol(inp, remove_hs=False) @@ -345,14 +364,14 @@ def encoder( attach_pos = sorted(attach_pos) starting_num = 1 if len(scf_branch_num) == 0 else max(scf_branch_num) + 1 for attach in attach_pos: - val = str(starting_num) if starting_num < 10 else f"%{starting_num}" + val = self._format_ring_closure(starting_num) # we cannot have anything of the form "\([@=-#-$/\]*\d+\)" attach_regexp = re.compile(r"(" + re.escape(attach) + r")") scaffold_str = attach_regexp.sub(val, scaffold_str) starting_num += 1 # now we need to remove all the parenthesis around digit only number - wrong_attach = re.compile(r"\(([\%\d]*)\)") + wrong_attach = re.compile(r"(?", scaffold_str) # furthermore, we autoapply rdkit-compatible digit standardization. if rdkit_safe: diff --git a/tests/test_safe.py b/tests/test_safe.py index b7e16a2..18f58bd 100644 --- a/tests/test_safe.py +++ b/tests/test_safe.py @@ -146,3 +146,40 @@ def test_stereochemistry_issue(): # check if we ignore the stereo output = safe.encode(STEREO_MOL_LIST[0], ignore_stereo=True, slicer="brics") assert dm.same_mol(dm.remove_stereochemistry(dm.to_mol(STEREO_MOL_LIST[0])), output) + + +def test_large_molecule_ring_closures(): + # A long peptide produces > 99 SAFE fragments, whose attachment bonds need + # the %(nnn) extended ring-closure form to be valid SMILES. + from rdkit import Chem + + seq = "LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ" + smiles = Chem.MolToSmiles(Chem.MolFromSequence(seq)) + encoded = safe.encode(smiles, canonical=True) + assert "%(" in encoded # uses extended ring closures + assert dm.same_mol(smiles, safe.decode(encoded)) + + +def test_extended_ring_closure_decoding(): + # The decoder must understand RDKit's extended '%(nnn)' ring-closure form, + # both when reading branch numbers and when completing unpaired attachment + # points. + from rdkit import Chem + + conv = safe.SAFEConverter() + + # '%(nnn)' is a single ring-closure label, not three separate digits + assert conv._find_branch_number("C%(100)") == [100] + assert conv._find_branch_number("c1ccccc1%(123)") == [1, 1, 123] + # plain single-digit and two-digit forms keep their existing behaviour + assert conv._find_branch_number("C1CC%23C") == [1, 23] + + # an unpaired extended label must be completed into a valid molecule + assert dm.to_mol(conv._ensure_valid("C%(100)")) is not None + + # fragment-level decoding of a >99 ring-closure molecule must not silently fail + seq = "LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ" + encoded = safe.encode(Chem.MolToSmiles(Chem.MolFromSequence(seq)), canonical=True) + decoded_fragments = [safe.decode(fragment, fix=True) for fragment in encoded.split(".")] + assert all(x is not None for x in decoded_fragments) + assert safe.decode(encoded, as_mol=True) is not None