Can not reproduce the result of 8VL9 in the paper

[ZRJie316]

Thanks for your job!

I try to reproduce your results, but failed. Is there a way to reproduce the results in the paper?
For 8VL9, the predicted result is:

The cmd I use: fksfold fold --use-msa-server --use-templates-server 8VL9.test.fasta 8VL9.test.fasta.output ''

The fasta (only keep the MG and the nearby 2 chains):

>protein|name=chainA
GPMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
>protein|name=chainD
GMEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
>ligand|name=A1ACI
CC(C)(C)C(NC(C)=O)C(=O)N1CC(O)CC1C(=O)NCc1ccc(c2cc[NH]n2)c2ccccc12

[jindavid]

Hi! Were you able to reproduce other numbers? Thank you!